Recombinant Human CNTF protein, GST-tagged
Cat.No. : | CNTF-11409H |
Product Overview : | Recombinant Human CNTF protein(1-200 aa), fused with N-terminal GST tag, was expressed in E. coli. |
Availability | September 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-200 aa |
Tag : | N-GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens ] |
Official Symbol | CNTF |
Synonyms | CNTF; ciliary neurotrophic factor; HCNTF; |
Gene ID | 1270 |
mRNA Refseq | NM_000614 |
Protein Refseq | NP_000605 |
MIM | 118945 |
UniProt ID | P26441 |
◆ Recombinant Proteins | ||
Cntf-579R | Recombinant Rat CNTF protein(Met1-Met200) | +Inquiry |
CNTF-1606H | Recombinant Human CNTF Protein, GST-tagged | +Inquiry |
CNTF-43H | Recombinant Active Human CNTF Protein, His-tagged(C-ter) | +Inquiry |
CNTF-435C | Active Recombinant Human CNTF Protein (199 aa) | +Inquiry |
CNTF-261H | Recombinant Full Length Human ciliary neurotrophic factor Protein, Tag Free | +Inquiry |
◆ Native Proteins | ||
CNTF-26839TH | Native Human CNTF | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *