Recombinant Human CNTF protein, GST-tagged
| Cat.No. : | CNTF-11409H |
| Product Overview : | Recombinant Human CNTF protein(1-200 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | July 28, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-200 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM |
| Gene Name | CNTF ciliary neurotrophic factor [ Homo sapiens ] |
| Official Symbol | CNTF |
| Synonyms | CNTF; ciliary neurotrophic factor; HCNTF; |
| Gene ID | 1270 |
| mRNA Refseq | NM_000614 |
| Protein Refseq | NP_000605 |
| MIM | 118945 |
| UniProt ID | P26441 |
| ◆ Recombinant Proteins | ||
| CNTF-39H | Active Recombinant Human CNTF Protein | +Inquiry |
| CNTF-1236M | Recombinant Mouse CNTF protein, His-tagged | +Inquiry |
| CNTF-058H | Active Recombinant Human CNTF protein, His-tagged | +Inquiry |
| CNTF-587P | Recombinant Pig CNTF protein, His & T7-tagged | +Inquiry |
| CNTF-1157R | Recombinant Rat CNTF Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CNTF-26839TH | Native Human CNTF | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNTF-376HCL | Recombinant Human CNTF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNTF Products
Required fields are marked with *
My Review for All CNTF Products
Required fields are marked with *



