Recombinant Human COL4A1 protein, His-SUMO-tagged
Cat.No. : | COL4A1-2713H |
Product Overview : | Recombinant Human COL4A1 protein(P02462)(1445-1669aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1445-1669aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 40.9 kDa |
AA Sequence : | GFLVTRHSQTIDDPQCPSGTKILYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTPEPMPMSMAPITGENIRPFISRCAVCEAPAMVMAVHSQTIQIPPCPSGWSSLWIGYSFVMHTSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPTPSTLKAGELRTHVSRCQVCMRRT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | COL4A1 collagen, type IV, alpha 1 [ Homo sapiens ] |
Official Symbol | COL4A1 |
Synonyms | COL4A1; collagen, type IV, alpha 1; collagen alpha-1(IV) chain; COL4A1 NC1 domain; collagen IV, alpha-1 polypeptide; collagen of basement membrane, alpha-1 chain; HANAC; POREN1; arresten; |
Gene ID | 1282 |
mRNA Refseq | NM_001845 |
Protein Refseq | NP_001836 |
MIM | 120130 |
UniProt ID | P02462 |
◆ Recombinant Proteins | ||
COL4A1-5269H | Recombinant Human COL4A1 protein, GST-tagged | +Inquiry |
Col4a1-821M | Recombinant Mouse Col4a1 protein(1445-1669aa), His-tagged | +Inquiry |
COL4A1-819C | Recombinant Cattle COL4A1 Protein, His-tagged | +Inquiry |
COL4A1-2713H | Recombinant Human COL4A1 protein, His-SUMO-tagged | +Inquiry |
COL4A1-1863M | Recombinant Mouse COL4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
COL4A1-001H | Native Human COL4A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COL4A1 Products
Required fields are marked with *
My Review for All COL4A1 Products
Required fields are marked with *
0
Inquiry Basket