Recombinant Human COL8A2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COL8A2-4491H |
Product Overview : | COL8A2 MS Standard C13 and N15-labeled recombinant protein (NP_005193) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the alpha 2 chain of type VIII collagen. This protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 67.24 kDa |
AA Sequence : | MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGVPGPRGEPGAVGPKGPPGVDGVGVPGAAGLPGPQGPSGAKGEPGTRGPPGLIGPTGYGMPGLPGPKGDRGPAGVPGLLGDRGEPGEDGEPGEQGPQGLGGPPGLPGSAGLPGRRGPPGPKGEAGPGGPPGVPGIRGDQGPSGLAGKPGVPGERGLPGAHGPPGPTGPKGEPGFTGRPGGPGVAGALGQKGDLGLPGQPGLRGPSGIPGLQGPAGPIGPQGLPGLKGEPGLPGPPGEGRAGEPGTAGPTGPPGVPGSPGITGPPGPPGPPGPPGAPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COL8A2 collagen type VIII alpha 2 chain [ Homo sapiens (human) ] |
Official Symbol | COL8A2 |
Synonyms | COL8A2; collagen, type VIII, alpha 2; FECD; collagen alpha-2(VIII) chain; PPCD; PPCD2; endothelial collagen; collagen VIII, alpha-2 polypeptide; dJ665N4.1 (collagen type VIII alpha 2); FECD1; FLJ00201; MGC116970; MGC116972; |
Gene ID | 1296 |
mRNA Refseq | NM_005202 |
Protein Refseq | NP_005193 |
MIM | 120252 |
UniProt ID | P25067 |
◆ Recombinant Proteins | ||
Col8a2-7887M | Recombinant Mouse Col8a2 protein, His-tagged | +Inquiry |
COL8A2-1661H | Recombinant Human COL8A2 Protein, GST-tagged | +Inquiry |
COL8A2-1771H | Recombinant Human COL8A2 Protein (Gln396-Thr703), N-His tagged | +Inquiry |
COL8A2-5276Z | Recombinant Zebrafish COL8A2 | +Inquiry |
Col8a2-2244M | Recombinant Mouse Col8a2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COL8A2-7375HCL | Recombinant Human COL8A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COL8A2 Products
Required fields are marked with *
My Review for All COL8A2 Products
Required fields are marked with *
0
Inquiry Basket