Recombinant Human COMP protein, His-tagged
| Cat.No. : | COMP-3183H |
| Product Overview : | Recombinant Human COMP protein(35-257 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 35-257 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAV |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | COMP cartilage oligomeric matrix protein [ Homo sapiens ] |
| Official Symbol | COMP |
| Synonyms | COMP; cartilage oligomeric matrix protein; cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) , EDM1, EPD1, PSACH; MED; THBS5; thrombospondin 5; TSP5; thrombospondin-5; pseudoachondroplasia (epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein(pseudoachondroplasia, epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple); EDM1; EPD1; PSACH; MGC131819; MGC149768; |
| Gene ID | 1311 |
| mRNA Refseq | NM_000095 |
| Protein Refseq | NP_000086 |
| MIM | 600310 |
| UniProt ID | P49747 |
| ◆ Recombinant Proteins | ||
| COMP-1947HF | Recombinant Full Length Human COMP Protein, GST-tagged | +Inquiry |
| COMP-3658H | Recombinant Human COMP, His-tagged | +Inquiry |
| Comp-5796R | Recombinant Rat Comp protein, His-tagged | +Inquiry |
| Comp-825R | Recombinant Rat Comp Protein, His-tagged | +Inquiry |
| COMP-3183H | Recombinant Human COMP protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COMP-3031HCL | Recombinant Human COMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMP Products
Required fields are marked with *
My Review for All COMP Products
Required fields are marked with *
