Recombinant Human COMP protein, His-tagged
Cat.No. : | COMP-3183H |
Product Overview : | Recombinant Human COMP protein(35-257 aa), fused to His tag, was expressed in E. coli. |
Availability | September 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 35-257 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTGNGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHQGVGLAFAKANKQVCTDINECETGQHNCVPNSVCINTRGSFQCGPCQPGFVGDQASGCQRRAQRFCPDGSPSECHEHADCVLERDGSRSCVCAV |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | COMP cartilage oligomeric matrix protein [ Homo sapiens ] |
Official Symbol | COMP |
Synonyms | COMP; cartilage oligomeric matrix protein; cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) , EDM1, EPD1, PSACH; MED; THBS5; thrombospondin 5; TSP5; thrombospondin-5; pseudoachondroplasia (epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein(pseudoachondroplasia, epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple); EDM1; EPD1; PSACH; MGC131819; MGC149768; |
Gene ID | 1311 |
mRNA Refseq | NM_000095 |
Protein Refseq | NP_000086 |
MIM | 600310 |
UniProt ID | P49747 |
◆ Recombinant Proteins | ||
COMP-185H | Recombinant Human COMP Protein, His-tagged | +Inquiry |
Comp-5795M | Recombinant Mouse Comp protein, His-tagged | +Inquiry |
COMP-674H | Active Recombinant Human COMP protein(Met1-Ala757), His-tagged | +Inquiry |
COMP-1528R | Recombinant Rat COMP Protein | +Inquiry |
COMP-26251TH | Recombinant Human COMP, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMP-3031HCL | Recombinant Human COMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMP Products
Required fields are marked with *
My Review for All COMP Products
Required fields are marked with *