Recombinant Human CORO1A Protein, GST-tagged

Cat.No. : CORO1A-1723H
Product Overview : Human CORO1A partial ORF ( NP_009005, 360 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010]
Molecular Mass : 36.96 kDa
AA Sequence : QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CORO1A coronin, actin binding protein, 1A [ Homo sapiens ]
Official Symbol CORO1A
Synonyms CORO1A; coronin, actin binding protein, 1A; coronin-1A; Clabp TACO; coronin 1; HCORO1; p57; clipin-A; coronin-1; coronin-like protein A; coronin-like protein p57; tryptophan aspartate-containing coat protein; TACO; CLABP; CLIPINA; FLJ41407; MGC117380;
Gene ID 11151
mRNA Refseq NM_001193333
Protein Refseq NP_001180262
MIM 605000
UniProt ID P31146

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CORO1A Products

Required fields are marked with *

My Review for All CORO1A Products

Required fields are marked with *

0
cart-icon
0
compare icon