Recombinant Human CORO1A Protein, GST-tagged
Cat.No. : | CORO1A-1723H |
Product Overview : | Human CORO1A partial ORF ( NP_009005, 360 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010] |
Molecular Mass : | 36.96 kDa |
AA Sequence : | QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CORO1A coronin, actin binding protein, 1A [ Homo sapiens ] |
Official Symbol | CORO1A |
Synonyms | CORO1A; coronin, actin binding protein, 1A; coronin-1A; Clabp TACO; coronin 1; HCORO1; p57; clipin-A; coronin-1; coronin-like protein A; coronin-like protein p57; tryptophan aspartate-containing coat protein; TACO; CLABP; CLIPINA; FLJ41407; MGC117380; |
Gene ID | 11151 |
mRNA Refseq | NM_001193333 |
Protein Refseq | NP_001180262 |
MIM | 605000 |
UniProt ID | P31146 |
◆ Recombinant Proteins | ||
CORO1A-1487HFL | Recombinant Full Length Human CORO1A Protein, C-Flag-tagged | +Inquiry |
Coro1a-1669R | Recombinant Rat Coro1a protein, His & T7-tagged | +Inquiry |
CORO1A-1545R | Recombinant Rat CORO1A Protein | +Inquiry |
CORO1A-1903M | Recombinant Mouse CORO1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO1A-1715H | Recombinant Human CORO1A Protein (Arg7-Glu204), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO1A-7345HCL | Recombinant Human CORO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO1A Products
Required fields are marked with *
My Review for All CORO1A Products
Required fields are marked with *