Recombinant Human CORO1A Protein, GST-tagged
| Cat.No. : | CORO1A-1723H |
| Product Overview : | Human CORO1A partial ORF ( NP_009005, 360 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010] |
| Molecular Mass : | 36.96 kDa |
| AA Sequence : | QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CORO1A coronin, actin binding protein, 1A [ Homo sapiens ] |
| Official Symbol | CORO1A |
| Synonyms | CORO1A; coronin, actin binding protein, 1A; coronin-1A; Clabp TACO; coronin 1; HCORO1; p57; clipin-A; coronin-1; coronin-like protein A; coronin-like protein p57; tryptophan aspartate-containing coat protein; TACO; CLABP; CLIPINA; FLJ41407; MGC117380; |
| Gene ID | 11151 |
| mRNA Refseq | NM_001193333 |
| Protein Refseq | NP_001180262 |
| MIM | 605000 |
| UniProt ID | P31146 |
| ◆ Recombinant Proteins | ||
| CORO1A-1487HFL | Recombinant Full Length Human CORO1A Protein, C-Flag-tagged | +Inquiry |
| CORO1A-1202R | Recombinant Rat CORO1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| CORO1A-1723H | Recombinant Human CORO1A Protein, GST-tagged | +Inquiry |
| CORO1A-1715H | Recombinant Human CORO1A Protein (Arg7-Glu204), N-His tagged | +Inquiry |
| CORO1A-1903M | Recombinant Mouse CORO1A Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CORO1A-7345HCL | Recombinant Human CORO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO1A Products
Required fields are marked with *
My Review for All CORO1A Products
Required fields are marked with *
