Recombinant Human CORO1A Protein, GST-tagged

• Cat.No.: CORO1A-1723H
• Product Overview: Human CORO1A partial ORF ( NP_009005, 360 a.a. - 461 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. [provided by RefSeq, Sep 2010]
• Molecular Mass: 36.96 kDa
• AA Sequence: QEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CORO1A coronin, actin binding protein, 1A [ Homo sapiens ]
• Official Symbol: CORO1A
• Synonyms: CORO1A; coronin, actin binding protein, 1A; coronin-1A; Clabp TACO; coronin 1; HCORO1; p57; clipin-A; coronin-1; coronin-like protein A; coronin-like protein p57; tryptophan aspartate-containing coat protein; TACO; CLABP; CLIPINA; FLJ41407; MGC117380
• Gene ID: 11151
• mRNA Refseq: NM_001193333
• Protein Refseq: NP_001180262
• MIM: 605000
• UniProt ID: P31146