Recombinant Human COTL1 protein, GST-tagged
| Cat.No. : | COTL1-11483H |
| Product Overview : | Recombinant Human COTL1 protein(1-142 aa), fused with N-terminal GST tag, was expressed in E.coli. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-142 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | COTL1 coactosin-like 1 (Dictyostelium) [ Homo sapiens ] |
| Official Symbol | COTL1 |
| Synonyms | COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733; |
| Gene ID | 23406 |
| mRNA Refseq | NM_021149 |
| Protein Refseq | NP_066972 |
| MIM | 606748 |
| UniProt ID | Q14019 |
| ◆ Recombinant Proteins | ||
| COTL1-10372Z | Recombinant Zebrafish COTL1 | +Inquiry |
| COTL1-4004C | Recombinant Chicken COTL1 | +Inquiry |
| Cotl1-2276M | Recombinant Mouse Cotl1 Protein, Myc/DDK-tagged | +Inquiry |
| COTL1-1730H | Recombinant Human COTL1 Protein, GST-tagged | +Inquiry |
| COTL1-1990HF | Recombinant Full Length Human COTL1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COTL1-7338HCL | Recombinant Human COTL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COTL1 Products
Required fields are marked with *
My Review for All COTL1 Products
Required fields are marked with *
