Recombinant Human COTL1 Protein, GST-tagged

Cat.No. : COTL1-1730H
Product Overview : Human COTL1 full-length ORF ( AAH10884, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis. Although this gene has been reported to map to chromosome 17 in the Smith-Magenis syndrome region, the best alignments for this gene are to chromosome 16. The Smith-Magenis syndrome region is the site of two related pseudogenes. [provided by RefSeq, Jul 2008]
Molecular Mass : 41.36 kDa
AA Sequence : MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANYDAQTE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COTL1 coactosin-like 1 (Dictyostelium) [ Homo sapiens ]
Official Symbol COTL1
Synonyms COTL1; coactosin-like 1 (Dictyostelium); coactosin-like protein; CLP; FLJ43657; MGC19733;
Gene ID 23406
mRNA Refseq NM_021149
Protein Refseq NP_066972
MIM 606748
UniProt ID Q14019

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COTL1 Products

Required fields are marked with *

My Review for All COTL1 Products

Required fields are marked with *

0
cart-icon