Recombinant Human COX6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | COX6A2-1481H |
Product Overview : | COX6A2 MS Standard C13 and N15-labeled recombinant protein (NP_005196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. |
Molecular Mass : | 10.8 kDa |
AA Sequence : | MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | COX6A2 cytochrome c oxidase subunit VIa polypeptide 2 [ Homo sapiens (human) ] |
Official Symbol | COX6A2 |
Synonyms | COX6A2; cytochrome c oxidase subunit VIa polypeptide 2; cytochrome c oxidase subunit 6A2, mitochondrial; COX VIa-M; cytochrome c oxidase subunit VIA-muscle; cytochrome c oxidase polypeptide VIa-heart; COX6AH; COXVIAH; |
Gene ID | 1339 |
mRNA Refseq | NM_005205 |
Protein Refseq | NP_005196 |
MIM | 602009 |
UniProt ID | Q02221 |
◆ Cell & Tissue Lysates | ||
COX6A2-7330HCL | Recombinant Human COX6A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX6A2 Products
Required fields are marked with *
My Review for All COX6A2 Products
Required fields are marked with *
0
Inquiry Basket