Recombinant Human COX6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COX6A2-1481H |
| Product Overview : | COX6A2 MS Standard C13 and N15-labeled recombinant protein (NP_005196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity. |
| Molecular Mass : | 10.8 kDa |
| AA Sequence : | MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | COX6A2 cytochrome c oxidase subunit VIa polypeptide 2 [ Homo sapiens (human) ] |
| Official Symbol | COX6A2 |
| Synonyms | COX6A2; cytochrome c oxidase subunit VIa polypeptide 2; cytochrome c oxidase subunit 6A2, mitochondrial; COX VIa-M; cytochrome c oxidase subunit VIA-muscle; cytochrome c oxidase polypeptide VIa-heart; COX6AH; COXVIAH; |
| Gene ID | 1339 |
| mRNA Refseq | NM_005205 |
| Protein Refseq | NP_005196 |
| MIM | 602009 |
| UniProt ID | Q02221 |
| ◆ Recombinant Proteins | ||
| COX6A2-1741HFL | Recombinant Full Length Human COX6A2 Protein, C-Flag-tagged | +Inquiry |
| COX6A2-1481H | Recombinant Human COX6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| COX6A2-2724H | Recombinant Human COX6A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL2806BF | Recombinant Full Length Bovine Cytochrome C Oxidase Subunit 6A2, Mitochondrial(Cox6A2) Protein, His-Tagged | +Inquiry |
| COX6A2-1916M | Recombinant Mouse COX6A2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| COX6A2-7330HCL | Recombinant Human COX6A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6A2 Products
Required fields are marked with *
My Review for All COX6A2 Products
Required fields are marked with *



