Recombinant Human COX6A2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COX6A2-1481H
• Product Overview: COX6A2 MS Standard C13 and N15-labeled recombinant protein (NP_005196) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 2 (heart/muscle isoform) of subunit VIa, and polypeptide 2 is present only in striated muscles. Polypeptide 1 (liver isoform) of subunit VIa is encoded by a different gene, and is found in all non-muscle tissues. These two polypeptides share 66% amino acid sequence identity.
• Molecular Mass: 10.8 kDa
• AA Sequence: MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFRPYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COX6A2 cytochrome c oxidase subunit VIa polypeptide 2 [ Homo sapiens (human) ]
• Official Symbol: COX6A2
• Synonyms: COX6A2; cytochrome c oxidase subunit VIa polypeptide 2; cytochrome c oxidase subunit 6A2, mitochondrial; COX VIa-M; cytochrome c oxidase subunit VIA-muscle; cytochrome c oxidase polypeptide VIa-heart; COX6AH; COXVIAH
• Gene ID: 1339
• mRNA Refseq: NM_005205
• Protein Refseq: NP_005196
• MIM: 602009
• UniProt ID: Q02221