Recombinant Human CPN1 protein, His-tagged
Cat.No. : | CPN1-8437H |
Product Overview : | Recombinant Human CPN1 protein(P15169)(21-458aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-458aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 54.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | VTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA |
Gene Name | CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CPN1 |
Synonyms | CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792; |
Gene ID | 1369 |
mRNA Refseq | NM_001308 |
Protein Refseq | NP_001299 |
MIM | 603103 |
UniProt ID | P15169 |
◆ Recombinant Proteins | ||
CPN1-12039Z | Recombinant Zebrafish CPN1 | +Inquiry |
CPN1-5222H | Recombinant Human CPN1 protein, His-tagged | +Inquiry |
CPN1-847H | Recombinant Human CPN1 Protein, His-tagged | +Inquiry |
CPN1-1931M | Recombinant Mouse CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPN1-3532H | Recombinant Human CPN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPN1-7310HCL | Recombinant Human CPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CPN1 Products
Required fields are marked with *
My Review for All CPN1 Products
Required fields are marked with *
0
Inquiry Basket