Recombinant Human CRABP1 protein, GST-tagged
| Cat.No. : | CRABP1-3675H |
| Product Overview : | Recombinant Human CRABP1 protein(1-137 aa), fused to GST tag, was expressed in E. coli. |
| Availability | June 13, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-137 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MPNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLATWENENKIHCTQTLLEGDGPKTYWTSELANDELILTFGADDVVCTRIYVRE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CRABP1 cellular retinoic acid binding protein 1 [ Homo sapiens ] |
| Official Symbol | CRABP1 |
| Synonyms | CRABP1; cellular retinoic acid binding protein 1; cellular retinoic acid binding protein 1 , RBP5; cellular retinoic acid-binding protein 1; CRABP; CRABP I; CRABPI; cellular retinoic acid-binding protein I; RBP5; CRABP-I; |
| Gene ID | 1381 |
| mRNA Refseq | NM_004378 |
| Protein Refseq | NP_004369 |
| MIM | 180230 |
| UniProt ID | P29762 |
| ◆ Recombinant Proteins | ||
| CRABP1-1828H | Recombinant Human CRABP1 Protein, GST-tagged | +Inquiry |
| CRABP1-481H | Recombinant Human cellular retinoic acid binding protein 1 | +Inquiry |
| CRABP1-2730H | Recombinant Human CRABP1 protein, GST-tagged | +Inquiry |
| CRABP1-2253C | Recombinant Chicken CRABP1 | +Inquiry |
| CRABP1-1583R | Recombinant Rat CRABP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRABP1-197HCL | Recombinant Human CRABP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRABP1 Products
Required fields are marked with *
My Review for All CRABP1 Products
Required fields are marked with *
