Recombinant Human CRB1 protein, GST-tagged
Cat.No. : | CRB1-6756H |
Product Overview : | Recombinant Human CRB1 protein(30-188 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 30-188 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
AA Sequence : | NNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQGRHCDLEVD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Official Symbol | CRB1 |
Synonyms | CRB1; crumbs 1, cell polarity complex component; Crumbs 1, Cell Polarity Complex Component; Crumbs Family Member 1, Photoreceptor Morphogenesis Associated; Crumbs (Drosophila) Homolog 1; Crumbs Homolog 1 (Drosophila); Protein Crumbs Homolog 1; LCA8; RP12; protein crumbs homolog 1; crumbs family member 1, photoreceptor morphogenesis associated |
Gene ID | 23418 |
mRNA Refseq | NM_001193640 |
Protein Refseq | NP_001180569 |
MIM | 604210 |
UniProt ID | P82279 |
◆ Recombinant Proteins | ||
CRB1-1835H | Recombinant Human CRB1 Protein, GST-tagged | +Inquiry |
CRB1-6756H | Recombinant Human CRB1 protein, GST-tagged | +Inquiry |
CRB1-3880M | Recombinant Mouse CRB1 Protein | +Inquiry |
CRB1-4041Z | Recombinant Zebrafish CRB1 | +Inquiry |
CRB1-6755H | Recombinant Human CRB1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRB1 Products
Required fields are marked with *
My Review for All CRB1 Products
Required fields are marked with *