Recombinant Human CRB1 protein, His-tagged

• Cat.No.: CRB1-6755H
• Product Overview: Recombinant Human CRB1 protein(30-188 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 30-188 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: NNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQGRHCDLEVD
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: CRB1
• Synonyms: CRB1; crumbs 1, cell polarity complex component; Crumbs 1, Cell Polarity Complex Component; Crumbs Family Member 1, Photoreceptor Morphogenesis Associated; Crumbs (Drosophila) Homolog 1; Crumbs Homolog 1 (Drosophila); Protein Crumbs Homolog 1; LCA8; RP12; protein crumbs homolog 1; crumbs family member 1, photoreceptor morphogenesis associated
• Gene ID: 23418
• mRNA Refseq: NM_001193640
• Protein Refseq: NP_001180569
• MIM: 604210
• UniProt ID: P82279