Recombinant Human CRB1 Protein, GST-tagged
Cat.No. : | CRB1-1835H |
Product Overview : | Human CRB1 partial ORF ( NP_036208, 26 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.[provided by RefSeq, Apr 2012] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRB1 crumbs 1, cell polarity complex component [ Homo sapiens (human) ] |
Official Symbol | CRB1 |
Synonyms | CRB1; crumbs 1, cell polarity complex component; Crumbs 1, Cell Polarity Complex Component; Crumbs Family Member 1, Photoreceptor Morphogenesis Associated; Crumbs (Drosophila) Homolog 1; Crumbs Homolog 1 (Drosophila); Protein Crumbs Homolog 1; LCA8; RP12; protein crumbs homolog 1; crumbs family member 1, photoreceptor morphogenesis associated |
Gene ID | 23418 |
mRNA Refseq | NM_001193640 |
Protein Refseq | NP_001180569 |
MIM | 604210 |
UniProt ID | P82279 |
◆ Recombinant Proteins | ||
CRB1-6755H | Recombinant Human CRB1 protein, His-tagged | +Inquiry |
CRB1-1835H | Recombinant Human CRB1 Protein, GST-tagged | +Inquiry |
CRB1-1959M | Recombinant Mouse CRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRB1-3880M | Recombinant Mouse CRB1 Protein | +Inquiry |
CRB1-4041Z | Recombinant Zebrafish CRB1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRB1 Products
Required fields are marked with *
My Review for All CRB1 Products
Required fields are marked with *