Recombinant Human CRB1 Protein, GST-tagged

Cat.No. : CRB1-1835H
Product Overview : Human CRB1 partial ORF ( NP_036208, 26 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which is similar to the Drosophila crumbs protein and localizes to the inner segment of mammalian photoreceptors. In Drosophila crumbs localizes to the stalk of the fly photoreceptor and may be a component of the molecular scaffold that controls proper development of polarity in the eye. Mutations in this gene are associated with a severe form of retinitis pigmentosa, RP12, and with Leber congenital amaurosis. Alternate splicing results in multiple transcript variants, some protein coding and some non-protein coding.[provided by RefSeq, Apr 2012]
Molecular Mass : 37.73 kDa
AA Sequence : FCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTANNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQHGGICHQDPIYPVC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRB1 crumbs 1, cell polarity complex component [ Homo sapiens (human) ]
Official Symbol CRB1
Synonyms CRB1; crumbs 1, cell polarity complex component; Crumbs 1, Cell Polarity Complex Component; Crumbs Family Member 1, Photoreceptor Morphogenesis Associated; Crumbs (Drosophila) Homolog 1; Crumbs Homolog 1 (Drosophila); Protein Crumbs Homolog 1; LCA8; RP12; protein crumbs homolog 1; crumbs family member 1, photoreceptor morphogenesis associated
Gene ID 23418
mRNA Refseq NM_001193640
Protein Refseq NP_001180569
MIM 604210
UniProt ID P82279

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRB1 Products

Required fields are marked with *

My Review for All CRB1 Products

Required fields are marked with *

0
cart-icon
0
compare icon