Recombinant Human CREBBP protein, GST-tagged
Cat.No. : | CREBBP-301557H |
Product Overview : | Recombinant Human CREBBP (957-1030 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met957-Asn1030 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSN |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | CREBBP CREB binding protein [ Homo sapiens ] |
Official Symbol | CREBBP |
Synonyms | CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS; |
Gene ID | 1387 |
mRNA Refseq | NM_001079846 |
Protein Refseq | NP_001073315 |
MIM | 600140 |
UniProt ID | Q92793 |
◆ Recombinant Proteins | ||
CREBBP-301557H | Recombinant Human CREBBP protein, GST-tagged | +Inquiry |
CREBBP-22HCL | Recombinant Human CREBBP 293 Cell Lysate | +Inquiry |
CREBBP-1442H | Recombinant Human CREB Binding Protein, GST-tagged | +Inquiry |
Crebbp-168M | Active Recombinant Mouse Crebbp, His-tagged | +Inquiry |
Crebbp-1115M | Recombinant Mouse Crebbp protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBBP Products
Required fields are marked with *
My Review for All CREBBP Products
Required fields are marked with *