Recombinant Human CREBBP protein, GST-tagged
| Cat.No. : | CREBBP-301557H |
| Product Overview : | Recombinant Human CREBBP (957-1030 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met957-Asn1030 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDEKKPEVKVEVKEEEESSSN |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | CREBBP CREB binding protein [ Homo sapiens ] |
| Official Symbol | CREBBP |
| Synonyms | CREBBP; CREB binding protein; RSTS, Rubinstein Taybi syndrome; CREB-binding protein; CBP; KAT3A; RTS; RSTS; |
| Gene ID | 1387 |
| mRNA Refseq | NM_001079846 |
| Protein Refseq | NP_001073315 |
| MIM | 600140 |
| UniProt ID | Q92793 |
| ◆ Recombinant Proteins | ||
| CREBBP-194H | Recombinant Human CREBBP protein, GST-tagged | +Inquiry |
| CREBBP-01D | Recombinant Dog Crebbp Protein, His tagged | +Inquiry |
| CREBBP-847R | Recombinant Rhesus Macaque CREBBP Protein, His (Fc)-Avi-tagged | +Inquiry |
| CREBBP-1581H | Recombinant Human CREB Binding Protein, GST-tagged | +Inquiry |
| CREBBP-2815H | Recombinant Human CREBBP protein, His&FLAG-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CREBBP Products
Required fields are marked with *
My Review for All CREBBP Products
Required fields are marked with *



