Recombinant Human CRHR1

Cat.No. : CRHR1-27818TH
Product Overview : Recombinant fragment: SLQDQHCESL SLASNISGLQ CNASVDLIGT CWPRSPAGQL VVRPCPAFFY GVRYNTTNNG YRECLANGSW AARVNYSECQ EILNEEKKSK VHYHVAVI corresponding to amino acids 24-121 of Human CRF1 with an N terminal proprietary tag; Predicted MWt 36.41 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : This gene encodes a G-protein coupled receptor that binds neuropeptides of the corticotropin releasing hormone family that are major regulators of the hypothalamic-pituitary-adrenal pathway. The encoded protein is essential for the activation of signal transduction pathways that regulate diverse physiological processes including stress, reproduction, immune response and obesity. Alternative splicing results in multiple transcript variants one of which is a non-coding read-through transcript with the neighboring gene MGC57346.
Molecular Weight : 36.410kDa inclusive of tags
Tissue specificity : Predominantly expressed in the cerebellum, pituitary, cerebral cortex and olfactory lobe.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVI
Sequence Similarities : Belongs to the G-protein coupled receptor 2 family.
Gene Name CRHR1 corticotropin releasing hormone receptor 1 [ Homo sapiens ]
Official Symbol CRHR1
Synonyms CRHR1; corticotropin releasing hormone receptor 1; CRHR; corticotropin-releasing factor receptor 1; corticotropin releasing factor receptor; CRF R; CRF1;
Gene ID 1394
mRNA Refseq NM_004382
Protein Refseq NP_004373
MIM 122561
Uniprot ID P34998
Chromosome Location 17q12-q22
Pathway Class B/2 (Secretin family receptors), organism-specific biosystem; G alpha (s) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class B Secretin-like, organism-specific biosystem;
Function corticotrophin-releasing factor receptor activity; corticotropin-releasing hormone binding; peptide binding; protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRHR1 Products

Required fields are marked with *

My Review for All CRHR1 Products

Required fields are marked with *

0
cart-icon