Recombinant Human CRYAB protein(21-170 aa), C-His-tagged

• Cat.No.: CRYAB-2524H
• Product Overview: Recombinant Human CRYAB protein(P02511)(21-170 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-170 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT

Gene Information

• Gene Name: CRYAB crystallin, alpha B [ Homo sapiens ]
• Official Symbol: CRYAB
• Synonyms: CRYAB; crystallin, alpha B; CRYA2; alpha-crystallin B chain; HSPB5; heat shock protein beta-5; rosenthal fiber component; heat-shock 20 kD like-protein; renal carcinoma antigen NY-REN-27; CTPP2
• Gene ID: 1410
• mRNA Refseq: NM_001885
• Protein Refseq: NP_001876
• MIM: 123590
• UniProt ID: P02511