Recombinant Human CSF2 therapeutic protein(Sargramostim)
Cat.No. : | CSF2-P035H |
Product Overview : | Recombinant Human Colony Stimulating Factor 2 is a human recombinant granulocyte macrophage colony-stimulating factor (GM-CSF) expressed in yeast. It is a glycoprotein that is 127 residues. Substitution of Leu23 leads to a difference from native protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | Non |
Protein Length : | 127 aa |
Description : | The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. The expression product is the active ingredient of Immunex, Leucomax and Leukine. |
Molecular Mass : | 14.4 kDa |
AA Sequence : | APARSPSPSTQPWEHVNAIQEALRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLT KLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE |
Endotoxin : | < 1.0 EU per μg of the protein |
Purity : | >95% |
Storage : | Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles. |
Alias : | CSF2; GM CSF; GMCSF; Sargramostim |
Gene Name | CSF2 colony stimulating factor 2 (granulocyte-macrophage) [ Homo sapiens ] |
Official Symbol | CSF2 |
Synonyms | CSF2; colony stimulating factor 2 (granulocyte-macrophage); granulocyte-macrophage colony-stimulating factor; GM CSF; GMCSF; granulocyte macrophage colony stimulating factor; molgramostin; sargramostim; CSF; colony-stimulating factor; granulocyte-macrophage colony stimulating factor; MGC131935; MGC138897; |
Gene ID | 1437 |
mRNA Refseq | NM_000758 |
Protein Refseq | NP_000749 |
MIM | 138960 |
UniProt ID | P04141 |
Chromosome Location | 5q23-q31 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Calcium signaling in the CD4+ TCR pathway, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; |
Function | cytokine activity; granulocyte macrophage colony-stimulating factor receptor binding; growth factor activity; protein binding; |
◆ Recombinant Proteins | ||
CSF2-327M | Active Recombinant Mouse CSF2 protein, His-tagged | +Inquiry |
CSF2-2419H | Recombinant Human CSF2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CSF2-79B | Active Recombinant Bovine GM-CSF | +Inquiry |
GM-CSF-368E | Recombinant Equine GM-CSF | +Inquiry |
Csf2-303M | Recombinant Mouse Csf2 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF2-1008MCL | Recombinant Mouse CSF2 cell lysate | +Inquiry |
CSF2-740RCL | Recombinant Rat CSF2 cell lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSF2 Products
Required fields are marked with *
My Review for All CSF2 Products
Required fields are marked with *