Recombinant Human CST3 protein
Cat.No. : | CST3-376H |
Product Overview : | Recombinant Human CST3 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 120 |
Description : | Cystatin C is a member of family 2 of the Cystatin superfamily. It is involved in processes such as tumor invasion and metastasis, inflammation and some neurological diseases. It inhibits many cysteine proteases such as papain and cathepsins B, H, K, L and S. It is ubiquitous in human tissues and body fluids. A point mutation in the gene coding for the 120 amino acid mature Cystatin C causes a hereditary form of amyloid angiopathy in which the protein variant (Leu68 to Gln) is deposited in the cerebral arteries, leading to fatal cerebral hemorrhage. Cystatin C may have additional clinical applications. For example, it is a good marker for glomerular filtration rate. |
Form : | Supplied as a 0.2μm filtered solution in 20mM Tris-HCl, pH 8.0, 300 mM NaCl, with 50 % glycerol. |
Molecular Mass : | Approximately 13.3 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids. |
AA Sequence : | SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
Endotoxin : | Less than 0.1 EU/µg of rHuCystatin-C as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening. |
Gene Name | CST3 |
Official Symbol | CST3 |
Synonyms | CST3; cystatin C; cystatin C (amyloid angiopathy and cerebral hemorrhage); cystatin-C; cystatin 3; cystatin-3; gamma-trace; post-gamma-globulin; bA218C14.4 (cystatin C); neuroendocrine basic polypeptide; ARMD11; MGC117328; |
Gene ID | 1471 |
mRNA Refseq | NM_000099 |
Protein Refseq | NP_000090 |
MIM | 604312 |
UniProt ID | P01034 |
◆ Recombinant Proteins | ||
Cst3-3670R | Recombinant Rat Cst3, His-tagged | +Inquiry |
Cst3-3669M | Recombinant Mouse Cst3, His-tagged | +Inquiry |
CST3-7899P | Recombinant Pig CST3 protein, His & GST-tagged | +Inquiry |
CST3-373M | Recombinant Mouse CST3 Protein, His-tagged | +Inquiry |
CST3-2044H | Recombinant Human CST3 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
CST3-4309H | Native Human CST3 Protein | +Inquiry |
CST3-26152TH | Native Human CST3 | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST3-2470MCL | Recombinant Mouse CST3 cell lysate | +Inquiry |
CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST3 Products
Required fields are marked with *
My Review for All CST3 Products
Required fields are marked with *
0
Inquiry Basket