Recombinant Human CST3 protein

Cat.No. : CST3-376H
Product Overview : Recombinant Human CST3 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 120
Description : Cystatin C is a member of family 2 of the Cystatin superfamily. It is involved in processes such as tumor invasion and metastasis, inflammation and some neurological diseases. It inhibits many cysteine proteases such as papain and cathepsins B, H, K, L and S. It is ubiquitous in human tissues and body fluids. A point mutation in the gene coding for the 120 amino acid mature Cystatin C causes a hereditary form of amyloid angiopathy in which the protein variant (Leu68 to Gln) is deposited in the cerebral arteries, leading to fatal cerebral hemorrhage. Cystatin C may have additional clinical applications. For example, it is a good marker for glomerular filtration rate.
Form : Supplied as a 0.2μm filtered solution in 20mM Tris-HCl, pH 8.0, 300 mM NaCl, with 50 % glycerol.
Molecular Mass : Approximately 13.3 kDa, a single non-glycosylated polypeptide chain containing 120 amino acids.
AA Sequence : SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA
Endotoxin : Less than 0.1 EU/µg of rHuCystatin-C as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 6 months from date of receipt, -20 to -70 centigrade as supplied. 3 months, -20 to -70 centigrade under sterile conditions after opening.
Gene Name CST3
Official Symbol CST3
Synonyms CST3; cystatin C; cystatin C (amyloid angiopathy and cerebral hemorrhage); cystatin-C; cystatin 3; cystatin-3; gamma-trace; post-gamma-globulin; bA218C14.4 (cystatin C); neuroendocrine basic polypeptide; ARMD11; MGC117328;
Gene ID 1471
mRNA Refseq NM_000099
Protein Refseq NP_000090
MIM 604312
UniProt ID P01034

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CST3 Products

Required fields are marked with *

My Review for All CST3 Products

Required fields are marked with *

0
cart-icon