Recombinant Human CST3 Protein, GST-tagged
Cat.No. : | CST3-2025H |
Product Overview : | Human CST3 full-length ORF ( AAH13083, 1 a.a. - 146 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virtually all organs of the body. A mutation in this gene has been associated with amyloid angiopathy. Expression of this protein in vascular wall smooth muscle cells is severely reduced in both atherosclerotic and aneurysmal aortic lesions, establishing its role in vascular disease. In addition, this protein has been shown to have an antimicrobial function, inhibiting the replication of herpes simplex virus. Alternative splicing results in multiple transcript variants encoding a single protein. [provided by RefSeq, Nov 2014] |
Molecular Mass : | 41.69 kDa |
AA Sequence : | MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CST3 cystatin C [ Homo sapiens ] |
Official Symbol | CST3 |
Synonyms | CST3; cystatin C; cystatin C (amyloid angiopathy and cerebral hemorrhage); cystatin-C; cystatin 3; cystatin-3; gamma-trace; post-gamma-globulin; bA218C14.4 (cystatin C); neuroendocrine basic polypeptide; ARMD11; MGC117328; |
Gene ID | 1471 |
mRNA Refseq | NM_000099 |
Protein Refseq | NP_000090 |
MIM | 604312 |
UniProt ID | P01034 |
◆ Recombinant Proteins | ||
CST3-3666H | Active Recombinant Full Length human Cystatin C protein, His tagged | +Inquiry |
CST3-893R | Recombinant Rhesus Macaque CST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST3-2744H | Recombinant Human CST3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST3-1845H | Recombinant Human CST3 Protein (Gly26-Ala146), N-His tagged | +Inquiry |
CST3-7899P | Recombinant Pig CST3 protein, His & GST-tagged | +Inquiry |
◆ Native Proteins | ||
CST3-26152TH | Native Human CST3 | +Inquiry |
CST3-8100H | Native Human Cystatin C (Cystatin 3) | +Inquiry |
CST3-4309H | Native Human CST3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CST3-2470MCL | Recombinant Mouse CST3 cell lysate | +Inquiry |
CST3-1938RCL | Recombinant Rat CST3 cell lysate | +Inquiry |
CST3-2991HCL | Recombinant Human CST3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CST3 Products
Required fields are marked with *
My Review for All CST3 Products
Required fields are marked with *