Recombinant Human CT45A3 protein, His-tagged

• Cat.No.: CT45A3-11653H
• Product Overview: Recombinant Human CT45A3 protein(1-189 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-189 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: CT45A3 cancer/testis antigen family 45, member A3 [ Homo sapiens ]
• Official Symbol: CT45A3
• Synonyms: CT45A3; cancer/testis antigen family 45, member A3; cancer/testis antigen family 45 member A3; cancer/testis antigen CT45 3; CT45 3; CT45.3; Cancer/testis antigen 45-3; Cancer/testis antigen 45A3; Cancer/testis antigen family 45 member A3; CT453_HUMAN; CT45A3; cancer/testis antigen 45-3; cancer/testis antigen 45A3; cancer/testis antigen CT45-3; CT45-3; RP13-36C9.1; RP13-36C9.3
• Gene ID: 441519
• mRNA Refseq: NM_001017435
• Protein Refseq: NP_001017435
• MIM: 300794
• UniProt ID: Q8NHU0