Recombinant Human CT45A3 Protein, GST-tagged
Cat.No. : | CT45A3-2045H |
Product Overview : | Human CT45-4 full-length ORF ( AAI53114.1, 1 a.a. - 189 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-189 a.a. |
Description : | CT45A3 (Cancer/Testis Antigen Family 45 Member A3) is a Protein Coding gene. An important paralog of this gene is CT45A6. |
Molecular Mass : | 47.19 kDa |
AA Sequence : | MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTSSFSGDDLECRETASSPKSQQEINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CT45A3 cancer/testis antigen family 45, member A3 [ Homo sapiens ] |
Official Symbol | CT45A3 |
Synonyms | CT45A3; cancer/testis antigen family 45, member A3; cancer/testis antigen family 45 member A3; cancer/testis antigen CT45 3; CT45 3; CT45.3; Cancer/testis antigen 45-3; Cancer/testis antigen 45A3; Cancer/testis antigen family 45 member A3; CT453_HUMAN; CT45A3; cancer/testis antigen 45-3; cancer/testis antigen 45A3; cancer/testis antigen CT45-3; CT45-3; RP13-36C9.1; RP13-36C9.3 |
Gene ID | 441519 |
mRNA Refseq | NM_001017435 |
Protein Refseq | NP_001017435 |
MIM | 300794 |
UniProt ID | Q8NHU0 |
◆ Recombinant Proteins | ||
CT45A3-11653H | Recombinant Human CT45A3, His-tagged | +Inquiry |
CT45A3-2254HF | Recombinant Full Length Human CT45A3 Protein, GST-tagged | +Inquiry |
CT45A3-3364H | Recombinant Human CT45A3 Protein, MYC/DDK-tagged | +Inquiry |
CT45A3-1215H | Recombinant Human CT45A3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CT45A3-2045H | Recombinant Human CT45A3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CT45A3-1536HCL | Recombinant Human CT45A3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CT45A3 Products
Required fields are marked with *
My Review for All CT45A3 Products
Required fields are marked with *