Recombinant Human CTAG2 protein, His-SUMO-tagged
| Cat.No. : | CTAG2-2751H |
| Product Overview : | Recombinant Human CTAG2 protein(O75638)(1-210aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 1-210aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 37.1 kDa |
| AA Sequence : | MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | CTAG2 cancer/testis antigen 2 [ Homo sapiens ] |
| Official Symbol | CTAG2 |
| Synonyms | CTAG2; cancer/testis antigen 2; CAMEL; cancer/testis antigen family 6; member 2a; member 2b; CT6.2a; CT6.2b; CTL recognized antigen on melanoma; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; cancer/testis antigen 6.2; l antigen family member 1; CTL-recognized antigen on melanoma; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; autoimmunogenic cancer/testis antigen NY-ESO-2; CT2; CT6.2; LAGE-1; LAGE2B; |
| Gene ID | 30848 |
| mRNA Refseq | NM_020994 |
| Protein Refseq | NP_066274 |
| MIM | 300396 |
| UniProt ID | O75638 |
| ◆ Recombinant Proteins | ||
| CTAG2-2751H | Recombinant Human CTAG2 protein, His-SUMO-tagged | +Inquiry |
| CTAG2-146H | Recombinant Human CTAG2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CTAG2-492H | Recombinant Human CTAG2, His-tagged | +Inquiry |
| CTAG2-2471H | Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTAG2-7217HCL | Recombinant Human CTAG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG2 Products
Required fields are marked with *
My Review for All CTAG2 Products
Required fields are marked with *
