Recombinant Human CTAG2 protein, His-SUMO-tagged

Cat.No. : CTAG2-2751H
Product Overview : Recombinant Human CTAG2 protein(O75638)(1-210aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-210aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 37.1 kDa
AA Sequence : MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name CTAG2 cancer/testis antigen 2 [ Homo sapiens ]
Official Symbol CTAG2
Synonyms CTAG2; cancer/testis antigen 2; CAMEL; cancer/testis antigen family 6; member 2a; member 2b; CT6.2a; CT6.2b; CTL recognized antigen on melanoma; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; cancer/testis antigen 6.2; l antigen family member 1; CTL-recognized antigen on melanoma; cancer/testis antigen family 6, member 2a; cancer/testis antigen family 6, member 2b; autoimmunogenic cancer/testis antigen NY-ESO-2; CT2; CT6.2; LAGE-1; LAGE2B;
Gene ID 30848
mRNA Refseq NM_020994
Protein Refseq NP_066274
MIM 300396
UniProt ID O75638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG2 Products

Required fields are marked with *

My Review for All CTAG2 Products

Required fields are marked with *

0
cart-icon
0
compare icon