Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged
Cat.No. : | CTAG2-2471H |
Product Overview : | Recombinant Human CTAG2 Protein (1-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 1-210 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 37.1 kDa |
AA Sequence : | MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | CTAG2 cancer/testis antigen 2 [ Homo sapiens ] |
Official Symbol | CTAG2 |
Synonyms | CTAG2; CAMEL; member 2a; member 2b; CT6.2a; CT6.2b; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; CT2; CT6.2; LAGE-1; LAGE2B; |
Gene ID | 30848 |
mRNA Refseq | NM_020994 |
Protein Refseq | NP_066274 |
MIM | 300396 |
UniProt ID | O75638 |
◆ Recombinant Proteins | ||
CTAG2-146H | Recombinant Human CTAG2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
CTAG2-2471H | Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged | +Inquiry |
CTAG2-2751H | Recombinant Human CTAG2 protein, His-SUMO-tagged | +Inquiry |
CTAG2-492H | Recombinant Human CTAG2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTAG2-7217HCL | Recombinant Human CTAG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTAG2 Products
Required fields are marked with *
My Review for All CTAG2 Products
Required fields are marked with *