Recombinant Human CTAG2 Protein (1-210 aa), His-sumostar-tagged

Cat.No. : CTAG2-2471H
Product Overview : Recombinant Human CTAG2 Protein (1-210 aa) is produced by Yeast expression system. This protein is fused with a 6xHis-sumostar tag at the N-terminal. Protein Description: Full Length.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His&SUMO
Protein Length : 1-210 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 37.1 kDa
AA Sequence : MQAEGQGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name CTAG2 cancer/testis antigen 2 [ Homo sapiens ]
Official Symbol CTAG2
Synonyms CTAG2; CAMEL; member 2a; member 2b; CT6.2a; CT6.2b; ESO2; LAGE 1; LAGE 1a; LAGE 1a protein; LAGE 1b; LAGE1; MGC3803; MGC138724; LAGE-1a protein; CT2; CT6.2; LAGE-1; LAGE2B;
Gene ID 30848
mRNA Refseq NM_020994
Protein Refseq NP_066274
MIM 300396
UniProt ID O75638

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTAG2 Products

Required fields are marked with *

My Review for All CTAG2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon