Recombinant Human CTDSPL Protein, GST-tagged

Cat.No. : CTDSPL-2063H
Product Overview : Human CTDSPL full-length ORF ( NP_005799.2, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : CTDSPL (CTD Small Phosphatase Like) is a Protein Coding gene. Among its related pathways are Regulation of cytoplasmic and nuclear SMAD2/3 signaling and Signaling by BMP. GO annotations related to this gene include phosphatase activity and phosphoprotein phosphatase activity. An important paralog of this gene is CTDSP1.
Molecular Mass : 56.3 kDa
AA Sequence : MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CTDSPL CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like [ Homo sapiens ]
Official Symbol CTDSPL
Synonyms CTDSPL; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like; C3orf8, chromosome 3 open reading frame 8; CTD small phosphatase-like protein; HYA22; HYA22 protein; PSR1; RB protein serine phosphatase from chromosome 3; RBSP3; SCP3; small CTD phosphatase 3; CTDSP-like; NIF-like protein; NLI-interacting factor 1; small C-terminal domain phosphatase 3; nuclear LIM interactor-interacting factor 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; C3orf8;
Gene ID 10217
mRNA Refseq NM_001008392
Protein Refseq NP_001008393
MIM 608592
UniProt ID O15194

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CTDSPL Products

Required fields are marked with *

My Review for All CTDSPL Products

Required fields are marked with *

0
cart-icon