Recombinant Human CTDSPL Protein, GST-tagged
Cat.No. : | CTDSPL-2063H |
Product Overview : | Human CTDSPL full-length ORF ( NP_005799.2, 1 a.a. - 265 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CTDSPL (CTD Small Phosphatase Like) is a Protein Coding gene. Among its related pathways are Regulation of cytoplasmic and nuclear SMAD2/3 signaling and Signaling by BMP. GO annotations related to this gene include phosphatase activity and phosphoprotein phosphatase activity. An important paralog of this gene is CTDSP1. |
Molecular Mass : | 56.3 kDa |
AA Sequence : | MDGPAIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKPPAKYLLPEVTVLDYGKKCVVIDLDETLVHSSFKPISNADFIVPVEIDGTIHQVYVLKRPHVDEFLQRMGQLFECVLFTASLAKYADPVADLLDRWGVFRARLFRESCVFHRGNYVKDLSRLGRELSKVIIVDNSPASYIFHPENAVPVQSWFDDMTDTELLDLIPFFEGLSREDDVYSMLHRLCNR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTDSPL CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like [ Homo sapiens ] |
Official Symbol | CTDSPL |
Synonyms | CTDSPL; CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase-like; C3orf8, chromosome 3 open reading frame 8; CTD small phosphatase-like protein; HYA22; HYA22 protein; PSR1; RB protein serine phosphatase from chromosome 3; RBSP3; SCP3; small CTD phosphatase 3; CTDSP-like; NIF-like protein; NLI-interacting factor 1; small C-terminal domain phosphatase 3; nuclear LIM interactor-interacting factor 1; carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3; C3orf8; |
Gene ID | 10217 |
mRNA Refseq | NM_001008392 |
Protein Refseq | NP_001008393 |
MIM | 608592 |
UniProt ID | O15194 |
◆ Recombinant Proteins | ||
Ctdspl-2355M | Recombinant Mouse Ctdspl Protein, Myc/DDK-tagged | +Inquiry |
CTDSPL-2049M | Recombinant Mouse CTDSPL Protein, His (Fc)-Avi-tagged | +Inquiry |
CTDSPL-4019M | Recombinant Mouse CTDSPL Protein | +Inquiry |
CTDSPL-2269HF | Recombinant Full Length Human CTDSPL Protein, GST-tagged | +Inquiry |
CTDSPL-1922H | Recombinant Human CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) Small Phosphatase-Like, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTDSPL-7207HCL | Recombinant Human CTDSPL 293 Cell Lysate | +Inquiry |
CTDSPL-7208HCL | Recombinant Human CTDSPL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTDSPL Products
Required fields are marked with *
My Review for All CTDSPL Products
Required fields are marked with *
0
Inquiry Basket