Recombinant Human CTSH Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | CTSH-1619H |
| Product Overview : | CTSH MS Standard C13 and N15-labeled recombinant protein (NP_004381) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 37.4 kDa |
| AA Sequence : | MWATLPLLCAGAWLLGVPVCGAAELSVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGSCWTFSTTGALESAIAIATGKMLSLAEQQLVDCAQDFNNHGCQGGLPSQAFEYILYNKGIMGEDTYPYQGKDGYCKFQPGKAIGFVKDVANITIYDEEAMVEAVALYNPVSFAFEVTQDFMMYRTGIYSSTSCHKTPDKVNHAVLAVGYGEKNGIPYWIVKNSWGPQWGMNGYFLIERGKNMCGLAACASYPIPLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | CTSH cathepsin H [ Homo sapiens (human) ] |
| Official Symbol | CTSH |
| Synonyms | CTSH; cathepsin H; CPSB; pro-cathepsin H; ACC 4; ACC 5; aleurain; cathepsin B3; cathepsin BA; N-benzoylarginine-beta-naphthylamide hydrolase; ACC-4; ACC-5; minichain; MGC1519; DKFZp686B24257; |
| Gene ID | 1512 |
| mRNA Refseq | NM_004390 |
| Protein Refseq | NP_004381 |
| MIM | 116820 |
| UniProt ID | P09668 |
| ◆ Recombinant Proteins | ||
| CTSH-1889H | Recombinant Human CTSH Protein (Ala23-Val335), N-His tagged | +Inquiry |
| CTSH-11964Z | Recombinant Zebrafish CTSH | +Inquiry |
| CTSH-1619H | Recombinant Human CTSH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CTSH-2352HF | Recombinant Full Length Human CTSH Protein, GST-tagged | +Inquiry |
| Ctsh-2370M | Recombinant Mouse Ctsh Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CTSH-360H | Native Human Eosinophil Peroxidase | +Inquiry |
| CTSH-190H | Active Native Human Cathepsin H | +Inquiry |
| CTSH-27404TH | Native Human CTSH | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CTSH-001MCL | Recombinant Mouse CTSH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CTSH Products
Required fields are marked with *
My Review for All CTSH Products
Required fields are marked with *
