Recombinant Human CUL4A protein, His-tagged
Cat.No. : | CUL4A-407H |
Product Overview : | Recombinant Human CUL4A protein(NP_001008895)(460-759 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 460-759 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | RLLVGKSASVDAEKSMLSKLKHECGAAFTSKLEGMFKDMELSKDIMVHFKQHMQNQSDSGPIDLTVNILTMGYWPTYTPMEVHLTPEMIKLQEVFKAFYLGKHSGRKLQWQTTLGHAVLKAEFKEGKKEFQVSLFQTLVLLMFNEGDGFSFEEIKMATGIEDSELRRTLQSLACGKARVLIKSPKGKEVEDGDKFIFNGEFKHKLFRIKINQIQMKETVEEQVSTTERVFQDRQYQIDAAIVRIMKMRKTLGHNLLVSELYNQLKFPVKPGDLKKRIESLIDRDYMERDKDNPNQYHYVA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | CUL4A cullin 4A [ Homo sapiens ] |
Official Symbol | CUL4A |
Synonyms | CUL4A; cullin 4A; cullin-4A; CUL-4A; |
Gene ID | 8451 |
mRNA Refseq | NM_001008895 |
Protein Refseq | NP_001008895 |
MIM | 603137 |
UniProt ID | Q13619 |
◆ Recombinant Proteins | ||
CUL4A-407H | Recombinant Human CUL4A protein, His-tagged | +Inquiry |
CUL4A-11259Z | Recombinant Zebrafish CUL4A | +Inquiry |
CUL4A-2399HF | Recombinant Full Length Human CUL4A Protein, GST-tagged | +Inquiry |
CUL4A-02H | Recombinant Human CUL4A/NEDD8/RBX1 Complex Protein, His-Tagged | +Inquiry |
CUL4A-690H | Recombinant Human CUL4A Protein, Full Length, N-His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CUL4A-7182HCL | Recombinant Human CUL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CUL4A Products
Required fields are marked with *
My Review for All CUL4A Products
Required fields are marked with *
0
Inquiry Basket