Recombinant Full Length Human Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged
| Cat.No. : | RFL20493HF |
| Product Overview : | Recombinant Full Length Human CX3C chemokine receptor 1(CX3CR1) Protein (P49238) (1-355aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-355) |
| Form : | Lyophilized powder |
| AA Sequence : | MDQFPESVTENFEYDDLAEACYIGDIVVFGTVFLSIFYSVIFAIGLVGNLLVVFALTNSK KPKSVTDIYLLNLALSDLLFVATLPFWTHYLINEKGLHNAMCKFTTAFFFIGFFGSIFFI TVISIDRYLAIVLAANSMNNRTVQHGVTISLGVWAAAILVAAPQFMFTKQKENECLGDYP EVLQEIWPVLRNVETNFLGFLLPLLIMSYCYFRIIQTLFSCKNHKKAKAIKLILLVVIVF FLFWTPYNVMIFLETLKLYDFFPSCDMRKDLRLALSVTETVAFSHCCLNPLIYAFAGEKF RRYLYHLYGKCLAVLCGRSVHVDFSSSESQRSRHGSVLSSNFTYHTSDGDALLLL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | CX3CR1 |
| Synonyms | CX3CR1; CMKBRL1; GPR13; CX3C chemokine receptor 1; C-X3-C CKR-1; CX3CR1; Beta chemokine receptor-like 1; CMK-BRL-1; CMK-BRL1; Fractalkine receptor; G-protein coupled receptor 13; V28 |
| UniProt ID | P49238 |
| ◆ Recombinant Proteins | ||
| CX3CR1-28062TH | Recombinant Human CX3CR1 | +Inquiry |
| CX3CR1-2150H | Recombinant Human CX3CR1 Protein, GST-tagged | +Inquiry |
| RFL26790MF | Recombinant Full Length Mouse Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| RFL16386RF | Recombinant Full Length Rat Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| RFL26864OF | Recombinant Full Length Rabbit Cx3C Chemokine Receptor 1(Cx3Cr1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CX3CR1-7173HCL | Recombinant Human CX3CR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CX3CR1 Products
Required fields are marked with *
My Review for All CX3CR1 Products
Required fields are marked with *
