Recombinant Human CXCL10 Protein, MYC/DDK-tagged, C13 and N15-labeled
Cat.No. : | CXCL10-050H |
Product Overview : | CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. |
Molecular Mass : | 10.9 kDa |
AA Sequence : | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | CXCL10 C-X-C motif chemokine ligand 10 [ Homo sapiens (human) ] |
Official Symbol | CXCL10 |
Synonyms | CXCL10; C-X-C motif chemokine ligand 10; C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10; C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; gamma IP10; interferon-inducible cytokine IP-10; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10; |
Gene ID | 3627 |
mRNA Refseq | NM_001565 |
Protein Refseq | NP_001556 |
MIM | 147310 |
UniProt ID | P02778 |
◆ Recombinant Proteins | ||
CXCL10-08H-AF647 | Active Recombinant Human CXCL10 protein, Tag Free, Alexa Fluor 647 labeled | +Inquiry |
CXCL10-1508C | Recombinant Cynomolgus CXCL10 protein, His-tagged | +Inquiry |
CXCL10-1176R | Active Recombinant Rhesus Monkey CXCL10 Protein | +Inquiry |
Cxcl10-388C | Active Recombinant Cotton Rat Cxcl10, Met-tagged | +Inquiry |
CXCL10-101H | Recombinant Human CXCL10 Protein, DYKDDDDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL10-7172HCL | Recombinant Human CXCL10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCL10 Products
Required fields are marked with *
My Review for All CXCL10 Products
Required fields are marked with *