Recombinant Human CXCL10 Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : CXCL10-050H
Product Overview : CXCL10 MS Standard C13 and N15-labeled recombinant protein (NP_001556) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression.
Molecular Mass : 10.9 kDa
AA Sequence : MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CXCL10 C-X-C motif chemokine ligand 10 [ Homo sapiens (human) ]
Official Symbol CXCL10
Synonyms CXCL10; C-X-C motif chemokine ligand 10; C7; crg-2; gIP-10; IFI10; INP10; IP-10; mob-1; SCYB10; C-X-C motif chemokine 10; 10 kDa interferon gamma-induced protein; gamma IP10; interferon-inducible cytokine IP-10; protein 10 from interferon (gamma)-induced cell line; small inducible cytokine subfamily B (Cys-X-Cys), member 10; small-inducible cytokine B10;
Gene ID 3627
mRNA Refseq NM_001565
Protein Refseq NP_001556
MIM 147310
UniProt ID P02778

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0
cart-icon