| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
72 |
| Description : |
CXCL12 also known as SDF-1 is belonging to the CXC chemokine family. It is encoded by the CXCL12 gene. In recently study, Human CXCL12 is expressed as six isoforms that differ only in the C-terminal tail. And all SDF-1 isoforms undergo proteolytic processing of the first two N-terminal amino acids. In all SDF-1 isoforms, SDF-1β is the canonical sequence. It has the complete amino acids in the C-terminal tail. On the cell surface, the receptor for this chemokine is CXCR4 and syndecan4. CXCL12 is strongly chemotactic for T-lymphocytes, monocytes, but not neutrophils. CXCL12 is a very important factor in carcinogenesis and the neovascularisation linked to tumor progression. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using PHA and rHuIL-2 activated human peripheral blood T-lymphocytes is in a concentration range of 20-80 ng/ml. |
| Molecular Mass : |
Approximately 8.5 kDa, a single non-glycosylated polypeptide chain containing 72 amino acid residues. |
| AA Sequence : |
KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Endotoxin : |
Less than 1 EU/μg of rHuSDF-1β/CXCL12β as determined by LAL method. |
| Purity : |
>97% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |