Recombinant Human CXCL9 protein

Cat.No. : CXCL9-17H
Product Overview : Recombinant Human CXCL9 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 103
Description : CXCL9 is a T-cell chemoattractant induced by IFN-γ belonging to the CXC chemokine family and it is also known as Monokine induced by gamma interferon (MIG). CXCL9 is closely related to two other CXC chemokines called CXCL10 and CXCL11 and they all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3. CXCL9 is a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response and chemotactic for activated T-cells. Recombinant human CXCL9 contains 103 amino acids which is a single non-glycosylated polypeptide chain. The human CXCL9 shares 75 % and 67 % a.a. sequence identity with mouse and rat CXCL9.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood T-lymphocytes is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 11.7 kDa, a single non-glycosylated polypeptide chain containing 103 amino acids.
AA Sequence : TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT
Endotoxin : Less than 1 EU/μg of rHuMIG/CXCL9 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name CXCL9
Official Symbol CXCL9
Synonyms CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10;
Gene ID 4283
mRNA Refseq NM_002416
Protein Refseq NP_002407
MIM 601704
UniProt ID Q07325

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL9 Products

Required fields are marked with *

My Review for All CXCL9 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon