Recombinant Human CXCL9 protein, His&Myc-tagged
Cat.No. : | CXCL9-2775H |
Product Overview : | Recombinant Human CXCL9 protein(Q07325)(23-125aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-125aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | CXCL9 chemokine (C-X-C motif) ligand 9 [ Homo sapiens ] |
Official Symbol | CXCL9 |
Synonyms | CXCL9; chemokine (C-X-C motif) ligand 9; CMK, MIG, monokine induced by gamma interferon; C-X-C motif chemokine 9; crg 10; Humig; SCYB9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; CMK; MIG; crg-10; |
Gene ID | 4283 |
mRNA Refseq | NM_002416 |
Protein Refseq | NP_002407 |
MIM | 601704 |
UniProt ID | Q07325 |
◆ Recombinant Proteins | ||
CXCL9-2175H | Recombinant Human CXCL9 Protein, GST-tagged | +Inquiry |
Cxcl9-1982R | Recombinant Rat Cxcl9 protein, His & T7-tagged | +Inquiry |
CXCL9-1112R | Recombinant Rhesus monkey CXCL9 Protein, His-tagged | +Inquiry |
CXCL9-219H | Active Recombinant Human CXCL9 Protein (Thr21-Thr125), N-His tagged, Animal-free, Carrier-free | +Inquiry |
CXCL9-346H | Active Recombinant Mouse Chemokine (C-X-C Motif) Ligand 9, HIgG1 Fc-tagged | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CXCL9 Products
Required fields are marked with *
My Review for All CXCL9 Products
Required fields are marked with *
0
Inquiry Basket