Recombinant Mouse Cxcl9 protein, His-tagged
Cat.No. : | Cxcl9-2776M |
Product Overview : | Recombinant Mouse Cxcl9 protein(P18340)(22-126aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-126aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | Cxcl9 chemokine (C-X-C motif) ligand 9 [ Mus musculus ] |
Official Symbol | Cxcl9 |
Synonyms | CXCL9; chemokine (C-X-C motif) ligand 9; C-X-C motif chemokine 9; M119; protein m119; small-inducible cytokine B9; gamma interferon-induced monokine; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small inducible cytokine B subfamily (Cys-X-Cys), member 9; CMK; Mig; MuMIG; Scyb9; crg-10; BB139920; |
Gene ID | 17329 |
mRNA Refseq | NM_008599 |
Protein Refseq | NP_032625 |
◆ Recombinant Proteins | ||
CXCL9-553H | Recombinant Human CXCL9 | +Inquiry |
CXCL9-17H | Recombinant Human CXCL9 protein | +Inquiry |
CXCL9-849B | Recombinant Bovine CXCL9 protein | +Inquiry |
CXCL9-2300HF | Recombinant Full Length Human CXCL9 Protein, GST-tagged | +Inquiry |
CXCL9-4395C | Recombinant Cynomolgus Monkey CXCL9 Protein | +Inquiry |
◆ Native Proteins | ||
CXCL9-30233TH | Native Human CXCL9 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CXCL9-7165HCL | Recombinant Human CXCL9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cxcl9 Products
Required fields are marked with *
My Review for All Cxcl9 Products
Required fields are marked with *