Recombinant Mouse Cxcl9 protein, His-tagged

Cat.No. : Cxcl9-2776M
Product Overview : Recombinant Mouse Cxcl9 protein(P18340)(22-126aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 22-126aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 16.2 kDa
AA Sequence : TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Cxcl9 chemokine (C-X-C motif) ligand 9 [ Mus musculus ]
Official Symbol Cxcl9
Synonyms CXCL9; chemokine (C-X-C motif) ligand 9; C-X-C motif chemokine 9; M119; protein m119; small-inducible cytokine B9; gamma interferon-induced monokine; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma; small inducible cytokine B subfamily (Cys-X-Cys), member 9; CMK; Mig; MuMIG; Scyb9; crg-10; BB139920;
Gene ID 17329
mRNA Refseq NM_008599
Protein Refseq NP_032625

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Cxcl9 Products

Required fields are marked with *

My Review for All Cxcl9 Products

Required fields are marked with *

0
cart-icon