Recombinant Human CXCR7 protein, GST-tagged
Cat.No. : | CXCR7-25H |
Product Overview : | Recombinant Human CXCR7(1 a.a. - 362 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-362 a.a. |
Description : | This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 67.9 kDa |
AA Sequence : | MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTT GYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT NTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPF SIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | CXCR7 chemokine (C-X-C motif) receptor 7 [ Homo sapiens ] |
Official Symbol | CXCR7 |
Synonyms | CXCR7; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1 , CMKOR1; C-X-C chemokine receptor type 7; GPR159; RDC1; G protein-coupled receptor; chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1; CMKOR1; CXC-R7; CXCR-7; |
Gene ID | 57007 |
mRNA Refseq | NM_020311 |
Protein Refseq | NP_064707 |
MIM | 610376 |
UniProt ID | P25106 |
Chromosome Location | 2q37.3 |
Pathway | Chemokine receptors bind chemokines, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; |
Function | C-X-C chemokine receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity; |
◆ Cell & Tissue Lysates | ||
CXCR7-7159HCL | Recombinant Human CXCR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CXCR7 Products
Required fields are marked with *
My Review for All CXCR7 Products
Required fields are marked with *