Recombinant Human CXCR7 protein, GST-tagged

• Cat.No.: CXCR7-25H
• Product Overview: Recombinant Human CXCR7(1 a.a. - 362 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1-362 a.a.
• Description: This gene encodes a member of the G-protein coupled receptor family. Although this protein was earlier thought to be a receptor for vasoactive intestinal peptide (VIP), it is now considered to be an orphan receptor, in that its endogenous ligand has not been identified. The protein is also a coreceptor for human immunodeficiency viruses (HIV). Translocations involving this gene and HMGA2 on chromosome 12 have been observed in lipomas.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 67.9 kDa
• AA Sequence: MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTT GYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFT NTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPF SIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVT QCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: CXCR7 chemokine (C-X-C motif) receptor 7 [ Homo sapiens ]
• Official Symbol: CXCR7
• Synonyms: CXCR7; chemokine (C-X-C motif) receptor 7; chemokine orphan receptor 1 , CMKOR1; C-X-C chemokine receptor type 7; GPR159; RDC1; G protein-coupled receptor; chemokine orphan receptor 1; G-protein coupled receptor 159; G-protein coupled receptor RDC1 homolog; RDC-1; CMKOR1; CXC-R7; CXCR-7
• Gene ID: 57007
• mRNA Refseq: NM_020311
• Protein Refseq: NP_064707
• MIM: 610376
• UniProt ID: P25106
• Chromosome Location: 2q37.3
• Pathway: Chemokine receptors bind chemokines, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem
• Function: C-X-C chemokine receptor activity; G-protein coupled receptor activity; receptor activity; signal transducer activity