Recombinant Human CYB5A Protein (1-108 aa), His-tagged

• Cat.No.: CYB5A-13H
• Product Overview: Recombinant Human CYB5A Protein (1-108 aa), His-tagged, expressed in E. coli. CYB5A is a membrane-bound hemoprotein functioning as an electron carrier for membrane-bound oxygenases.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-108 aa
• Description: Cytochrome b5 type A (CYB5A) is a membrane-bound hemoprotein that functions as an electron carrier for several membrane-bound oxygenases. It is involved in fatty acid desaturation, steroid biosynthesis, and xenobiotic metabolism. CYB5A deficiency leads to type IV hereditary methemoglobinemia (autosomal recessive). Three transcript variants encoding different isoforms have been identified.
• Form: Liquid
• Molecular Mass: 14.9 kDa (132 aa including His-tag), confirmed by MALDI-TOF
• AASequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
• Purity: > 95% (by SDS-PAGE)
• Storage: +2°C to +8°C for 1 week; -20°C to -80°C for long term storage; avoid freeze-thaw cycles
• Concentration: 1 mg/mL (Bradford assay)
• Storage Buffer: 20 mM Tris-HCl (pH 8.0), 20% glycerol, 0.1 M NaCl

Gene Information

• Gene Name: CYB5A
• Official Symbol: CYB5A
• Synonyms: CYB5;MCB5;METAG
• Gene ID: 1528
• mRNA Refseq: NM_148923.4
• Protein Refseq: NP_683725.1
• MIM: 613218
• UniProt ID: P00167