Recombinant Human CYB5A protein, His-tagged
| Cat.No. : | CYB5A-22H |
| Product Overview : | Recombinant Human CYB5A(Met1-Asp134) fused with His tag at N-terminal was expressed in E. coli. |
| Availability | November 29, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-134 a.a. |
| Description : | Cytochrome b5 (CYB5A) is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. CYB5A contains one cytochrome b5 heme-binding domain and has two isoforms produced by alternative splicing. Isoform 1 is a sngle-pass membrane protein. Isoform 2 is located in cytoplasm. The defects in CYB5A can result in type IV hereditary methemoglobinemia. |
| Form : | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 0.1mM EDTA, pH 7.25. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHP GGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWW TNWVIPAISAVAVALMYRLYMAED |
| Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Gene Name | CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ] |
| Official Symbol | CYB5A |
| Synonyms | CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5; type 1 cyt-b5; CYB5; MCB5; |
| Gene ID | 1528 |
| mRNA Refseq | NM_001190807 |
| Protein Refseq | NP_001177736 |
| MIM | 613218 |
| UniProt ID | P00167 |
| Chromosome Location | 18q23 |
| Pathway | Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem; |
| Function | aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding; |
| ◆ Cell & Tissue Lysates | ||
| CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYB5A Products
Required fields are marked with *
My Review for All CYB5A Products
Required fields are marked with *
