Recombinant Human CYB5A protein, His-tagged

• Cat.No.: CYB5A-22H
• Product Overview: Recombinant Human CYB5A(Met1-Asp134) fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-134 a.a.
• Description: Cytochrome b5 (CYB5A) is a membrane bound hemoprotein which function as an electron carrier for several membrane bound oxygenases. CYB5A contains one cytochrome b5 heme-binding domain and has two isoforms produced by alternative splicing. Isoform 1 is a sngle-pass membrane protein. Isoform 2 is located in cytoplasm. The defects in CYB5A can result in type IV hereditary methemoglobinemia.
• Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 0.1mM EDTA, pH 7.25.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHP GGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWW TNWVIPAISAVAVALMYRLYMAED
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
• Purity: Greater than 95% as determined by reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
  Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
  Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
  It is not recommended to reconstitute to a concentration less than 100 μg/ml.
  Dissolve the lyophilized protein in ddH2O.
  Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ]
• Official Symbol: CYB5A
• Synonyms: CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5; type 1 cyt-b5; CYB5; MCB5
• Gene ID: 1528
• mRNA Refseq: NM_001190807
• Protein Refseq: NP_001177736
• MIM: 613218
• UniProt ID: P00167
• Chromosome Location: 18q23
• Pathway: Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem
• Function: aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding