Recombinant Human CYCS, His-tagged
Cat.No. : | CYCS-75H |
Product Overview : | Recombinant Human Cytochrome C/CYCS is produced with our E. coli expression system. The target protein is expressed with sequence (Gly2-Glu105) of Human CYCS fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-105 a.a. |
Description : | Cytochrome C (CYCS) is a small heme protein that belongs to the cytochrome c family. It is found loosely associated with the inner membrane of the mitochondrion. Cytochrome C is a highly soluble protein that functions as a central component of the electron transport chain in mitochondria. CYCS transfers electrons between Complexes III (Coenzyme Q - Cyt C reductase) and IV (Cyt C oxidase). CYCS plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of Cytochrome C to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris, 0.15M NaCl, 20% Glycerol, pH 8.0 |
AA Sequence : | MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTL MEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNELEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
Gene Name | CYCS cytochrome c, somatic [ Homo sapiens ] |
Official Symbol | CYCS |
Synonyms | CYCS; cytochrome c, somatic; cytochrome c; HCS; CYC; THC4; |
Gene ID | 54205 |
mRNA Refseq | NM_018947 |
Protein Refseq | NP_061820 |
MIM | 123970 |
UniProt ID | P99999 |
Chromosome Location | 7p21.2 |
Pathway | Activation of caspases through apoptosome-mediated cleavage, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; Apoptosis, organism-specific biosystem; Apoptosis, organism-specific biosystem; |
Function | electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding; protein binding; contributes_to protein serine/threonine phosphatase activity; |
◆ Recombinant Proteins | ||
CYCS-4135M | Recombinant Mouse CYCS Protein | +Inquiry |
CYCS-3518C | Recombinant Chicken CYCS | +Inquiry |
CYCS-1709R | Recombinant Rat CYCS Protein | +Inquiry |
CYCS-1368R | Recombinant Rat CYCS Protein, His (Fc)-Avi-tagged | +Inquiry |
CYCS-290H | Recombinant Human CYCS protein, His/MBP-tagged | +Inquiry |
◆ Native Proteins | ||
CYCS-17B | Native Bovine Cytochrome C Protein | +Inquiry |
CYTC-168E | Native Horse Cytochrome C | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYCS-7135HCL | Recombinant Human CYCS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYCS Products
Required fields are marked with *
My Review for All CYCS Products
Required fields are marked with *
0
Inquiry Basket