Recombinant Human CYP26C1 Protein, GST-tagged
Cat.No. : | CYP26C1-2252H |
Product Overview : | Human CYP26C1 partial ORF ( NP_899230.2, 423 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is involved in the catabolism of all-trans- and 9-cis-retinoic acid, and thus contributes to the regulation of retinoic acid levels in cells and tissues. This gene is adjacent to a related gene on chromosome 10q23.33. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 36.74 kDa |
AA Sequence : | SPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP26C1 cytochrome P450, family 26, subfamily C, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CYP26C1 |
Synonyms | CYP26C1; cytochrome P450, family 26, subfamily C, polypeptide 1; cytochrome P450 26C1; FLJ45301; |
Gene ID | 340665 |
mRNA Refseq | NM_183374 |
Protein Refseq | NP_899230 |
MIM | 608428 |
UniProt ID | Q6V0L0 |
◆ Recombinant Proteins | ||
CYP26C1-3181Z | Recombinant Zebrafish CYP26C1 | +Inquiry |
CYP26C1-2252H | Recombinant Human CYP26C1 Protein, GST-tagged | +Inquiry |
CYP26C1-3391H | Recombinant Human CYP26C1 Protein, MYC/DDK-tagged | +Inquiry |
CYP26C1-2679H | Recombinant Human CYP26C1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Cyp26c1-2416M | Recombinant Mouse Cyp26c1 Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CYP26C1 Products
Required fields are marked with *
My Review for All CYP26C1 Products
Required fields are marked with *
0
Inquiry Basket