Recombinant Human CYP26C1 Protein, GST-tagged

Cat.No. : CYP26C1-2252H
Product Overview : Human CYP26C1 partial ORF ( NP_899230.2, 423 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is involved in the catabolism of all-trans- and 9-cis-retinoic acid, and thus contributes to the regulation of retinoic acid levels in cells and tissues. This gene is adjacent to a related gene on chromosome 10q23.33. [provided by RefSeq, Jul 2008]
Molecular Mass : 36.74 kDa
AA Sequence : SPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CYP26C1 cytochrome P450, family 26, subfamily C, polypeptide 1 [ Homo sapiens ]
Official Symbol CYP26C1
Synonyms CYP26C1; cytochrome P450, family 26, subfamily C, polypeptide 1; cytochrome P450 26C1; FLJ45301;
Gene ID 340665
mRNA Refseq NM_183374
Protein Refseq NP_899230
MIM 608428
UniProt ID Q6V0L0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CYP26C1 Products

Required fields are marked with *

My Review for All CYP26C1 Products

Required fields are marked with *

0
cart-icon
0
compare icon