Recombinant Human CYP2A13 Protein, GST-tagged
Cat.No. : | CYP2A13-2256H |
Product Overview : | Human CYP2A13 full-length ORF ( AAI53001.1, 1 a.a. - 494 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 81.29 kDa |
AA Sequence : | MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CYP2A13 cytochrome P450, family 2, subfamily A, polypeptide 13 [ Homo sapiens ] |
Official Symbol | CYP2A13 |
Synonyms | CYP2A13; cytochrome P450, family 2, subfamily A, polypeptide 13; cytochrome P450, subfamily IIA (phenobarbital inducible), polypeptide 13; cytochrome P450 2A13; CPAD; CYP2A; cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13; CYPIIA13; |
Gene ID | 1553 |
mRNA Refseq | NM_000766 |
Protein Refseq | NP_000757 |
MIM | 608055 |
UniProt ID | Q16696 |
◆ Recombinant Proteins | ||
CYP2A13-6335H | Recombinant Human CYP2A13 protein, His&Myc-tagged | +Inquiry |
CYP2A13-2256H | Recombinant Human CYP2A13 Protein, GST-tagged | +Inquiry |
CYP2A13-2345HF | Recombinant Full Length Human CYP2A13 Protein, GST-tagged | +Inquiry |
CYP2A13-72H | Active Recombinant Human CYP2A13 Protein | +Inquiry |
CYP2A13-34H | Active Recombinant Human CYP2A13 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP2A13-433HCL | Recombinant Human CYP2A13 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CYP2A13 Products
Required fields are marked with *
My Review for All CYP2A13 Products
Required fields are marked with *