Recombinant Human DCD Protein, GST-tagged
| Cat.No. : | DCD-2388H |
| Product Overview : | Human DCD full-length ORF (AAH62682.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] |
| Molecular Mass : | 38.5 kDa |
| AA Sequence : | MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DCD dermcidin [ Homo sapiens ] |
| Official Symbol | DCD |
| Synonyms | DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930; |
| Gene ID | 117159 |
| mRNA Refseq | NM_053283 |
| Protein Refseq | NP_444513 |
| MIM | 606634 |
| UniProt ID | P81605 |
| ◆ Recombinant Proteins | ||
| DCD-2799H | Recombinant Human DCD Protein, His-tagged, OVA Conjugated | +Inquiry |
| DCD-1183S | Recombinant Streptomyces coelicolor A3(2) DCD protein, His-tagged | +Inquiry |
| DCD-2803H | Recombinant Human DCD protein, His-B2M-tagged | +Inquiry |
| DCD-650HFL | Recombinant Full Length Human DCD Protein, C-Flag-tagged | +Inquiry |
| DCD-1376H | Recombinant Human DCD Protein (20-110 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DCD-7053HCL | Recombinant Human DCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCD Products
Required fields are marked with *
My Review for All DCD Products
Required fields are marked with *
