Recombinant Human DCD Protein, GST-tagged
Cat.No. : | DCD-2388H |
Product Overview : | Human DCD full-length ORF (AAH62682.1, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014] |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DCD dermcidin [ Homo sapiens ] |
Official Symbol | DCD |
Synonyms | DCD; dermcidin; AIDD; DCD 1; diffusible survival/evasion peptide; DSEP; HCAP; PIF; preproteolysin; proteolysis inducing factor; survival promoting peptide; DCD-1; MGC71930; |
Gene ID | 117159 |
mRNA Refseq | NM_053283 |
Protein Refseq | NP_444513 |
MIM | 606634 |
UniProt ID | P81605 |
◆ Recombinant Proteins | ||
DCD-2798HF | Recombinant Full Length Human DCD Protein, GST-tagged | +Inquiry |
DCD-8144H | Recombinant Human DCD protein, His-tagged | +Inquiry |
DCD-1183S | Recombinant Streptomyces coelicolor A3(2) DCD protein, His-tagged | +Inquiry |
DCD-1739H | Recombinant Human DCD Protein (Cys18-Leu110), His tagged | +Inquiry |
DCD-650HFL | Recombinant Full Length Human DCD Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCD-7053HCL | Recombinant Human DCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DCD Products
Required fields are marked with *
My Review for All DCD Products
Required fields are marked with *