Recombinant Human DDX19B protein, His&Myc-tagged

Cat.No. : DDX19B-5323H
Product Overview : Recombinant Human DDX19B protein(Q9UMR2)(2-479aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc
Protein Length : 2-479a.a.
Tag : His&Myc
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 61.2 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN
Gene Name DDX19B DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B [ Homo sapiens ]
Official Symbol DDX19B
Synonyms DDX19B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B; DDX19, DEAD (Asp Glu Ala As) box polypeptide 19 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); ATP-dependent RNA helicase DDX19B; DBP5; DEAD-box protein 5; yeast Dbp5 homolog; DEAD box protein 19B; DEAD box RNA helicase DEAD5; DEAD-box RNA helicase DEAD5; ATP-dependent RNA helicase DDX19; DEAD (Asp-Glu-Ala-As) box polypeptide 19B; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); RNAh; DDX19;
Gene ID 11269
mRNA Refseq NM_001014449
Protein Refseq NP_001014449
MIM 605812
UniProt ID Q9UMR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DDX19B Products

Required fields are marked with *

My Review for All DDX19B Products

Required fields are marked with *

0
cart-icon
0
compare icon