Recombinant Human DDX19B protein, His&Myc-tagged
Cat.No. : | DDX19B-5323H |
Product Overview : | Recombinant Human DDX19B protein(Q9UMR2)(2-479aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-479a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 61.2 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN |
Gene Name | DDX19B DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B [ Homo sapiens ] |
Official Symbol | DDX19B |
Synonyms | DDX19B; DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B; DDX19, DEAD (Asp Glu Ala As) box polypeptide 19 , DEAD/H (Asp Glu Ala Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); ATP-dependent RNA helicase DDX19B; DBP5; DEAD-box protein 5; yeast Dbp5 homolog; DEAD box protein 19B; DEAD box RNA helicase DEAD5; DEAD-box RNA helicase DEAD5; ATP-dependent RNA helicase DDX19; DEAD (Asp-Glu-Ala-As) box polypeptide 19B; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 19 (Dbp5, yeast, homolog); RNAh; DDX19; |
Gene ID | 11269 |
mRNA Refseq | NM_001014449 |
Protein Refseq | NP_001014449 |
MIM | 605812 |
UniProt ID | Q9UMR2 |
◆ Recombinant Proteins | ||
DDX19B-8544H | Recombinant Human DDX19B protein, His-SUMO-tagged | +Inquiry |
DDX19B-11893H | Recombinant Human DDX19B, His-tagged | +Inquiry |
DDX19B-455C | Recombinant Cynomolgus DDX19B Protein, His-tagged | +Inquiry |
DDX19B-2468H | Recombinant Human DDX19B Protein, GST-tagged | +Inquiry |
DDX19B-2537HF | Recombinant Full Length Human DDX19B Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DDX19B-7017HCL | Recombinant Human DDX19B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DDX19B Products
Required fields are marked with *
My Review for All DDX19B Products
Required fields are marked with *
0
Inquiry Basket