Recombinant Human DDX24 protein, His-tagged
| Cat.No. : | DDX24-11897H |
| Product Overview : | Recombinant Human DDX24 protein(509-859 aa), fused with His tag, was expressed in E.coli. |
| Availability | December 01, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 509-859 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | TLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | DDX24 DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [ Homo sapiens ] |
| Official Symbol | DDX24 |
| Synonyms | DDX24; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 24; ATP-dependent RNA helicase DDX24; DEAD box protein 24; S. cerevisiae CHL1-like helicase; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24; |
| Gene ID | 57062 |
| mRNA Refseq | NM_020414 |
| Protein Refseq | NP_065147 |
| MIM | 606181 |
| UniProt ID | Q9GZR7 |
| ◆ Recombinant Proteins | ||
| DDX24-2563HF | Recombinant Full Length Human DDX24 Protein, GST-tagged | +Inquiry |
| DDX24-11897H | Recombinant Human DDX24 protein, His-tagged | +Inquiry |
| DDX24-2476H | Recombinant Human DDX24 Protein, GST-tagged | +Inquiry |
| DDX24-11898H | Recombinant Human DDX24 protein, GST-tagged | +Inquiry |
| DDX24-28324TH | Recombinant Human DDX24, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DDX24-7013HCL | Recombinant Human DDX24 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DDX24 Products
Required fields are marked with *
My Review for All DDX24 Products
Required fields are marked with *
