Recombinant Human DDX24 protein, His-tagged

• Cat.No.: DDX24-11897H
• Product Overview: Recombinant Human DDX24 protein(509-859 aa), fused with His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 509-859 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: TLTLVHQAPARILHKKHTKKMDKTAKLDLLMQKIGMRGKPKVIDLTRNEATVETLTETKIHCETDEKDFYLYYFLMQYPGRSLVFANSISCIKRLSGLLKVLDIMPLTLHACMHQKQRLRNLEQFARLEDCVLLATDVAARGLDIPKVQHVIHYQVPRTSEIYVHRSGRTARATNEGLSLMLIGPEDVINFKKIYKTLKKDEDIPLFPVQTKYMDVVKERIRLARQIEKSEYRNFQACLHNSWIEQAAAALEIELEEDMYKGGKADQQEERRRQKQMKVLKKELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKKTKKPKEPQPEQPQPSTSAN
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DDX24 DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 [ Homo sapiens ]
• Official Symbol: DDX24
• Synonyms: DDX24; DEAD (Asp-Glu-Ala-Asp) box polypeptide 24; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 24; ATP-dependent RNA helicase DDX24; DEAD box protein 24; S. cerevisiae CHL1-like helicase; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24
• Gene ID: 57062
• mRNA Refseq: NM_020414
• Protein Refseq: NP_065147
• MIM: 606181
• UniProt ID: Q9GZR7