Recombinant Human DHDDS Protein, His-tagged
| Cat.No. : | DHDDS-25H |
| Product Overview : | Recombinant Human DHDDS Protein(Q86SQ9)(41-210 aa), fused with C-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 41-210 aa |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 22 kDa |
| AASequence : | KKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEV |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | DHDDS dehydrodolichyl diphosphate synthase [ Homo sapiens ] |
| Official Symbol | DHDDS |
| Synonyms | DHDDS; dehydrodolichyl diphosphate synthase; DS; FLJ13102; HDS; dedol-PP synthase; cis-prenyl transferase; cis-isoprenyltransferase; CIT; CPT; RP59; |
| Gene ID | 79947 |
| mRNA Refseq | NM_001243564 |
| Protein Refseq | NP_001230493 |
| MIM | 608172 |
| UniProt ID | Q86SQ9 |
| ◆ Recombinant Proteins | ||
| DHDDS-2583H | Recombinant Human DHDDS Protein, GST-tagged | +Inquiry |
| DHDDS-25H | Recombinant Human DHDDS Protein, His-tagged | +Inquiry |
| DHDDS-12399Z | Recombinant Zebrafish DHDDS | +Inquiry |
| DHDDS-2138H | Recombinant Human DHDDS Protein (1-333 aa), GST-tagged | +Inquiry |
| Dhdds-2543M | Recombinant Mouse Dhdds Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DHDDS-6948HCL | Recombinant Human DHDDS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHDDS Products
Required fields are marked with *
My Review for All DHDDS Products
Required fields are marked with *
Recently Viewed
