Recombinant Human DHRS1 Protein, GST-tagged
Cat.No. : | DHRS1-2593H |
Product Overview : | Human DHRS1 full-length ORF ( NP_612461.1, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded enzyme contains a conserved catalytic domain and likely functions as an oxidoreductase. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Nov 2008] |
Molecular Mass : | 60.3 kDa |
AA Sequence : | MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVPYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DHRS1 dehydrogenase/reductase (SDR family) member 1 [ Homo sapiens ] |
Official Symbol | DHRS1 |
Synonyms | DHRS1; dehydrogenase/reductase (SDR family) member 1; dehydrogenase/reductase SDR family member 1; FLJ25430; MGC20204; SDR19C1; short chain dehydrogenase/reductase family 19C; member 1; short chain dehydrogenase/reductase family 19C, member 1; FLJ14250; DKFZp586I0523; |
Gene ID | 115817 |
mRNA Refseq | NM_138452 |
Protein Refseq | NP_612461 |
MIM | 610410 |
UniProt ID | Q96LJ7 |
◆ Recombinant Proteins | ||
DHRS1-2534HF | Recombinant Full Length Human DHRS1 Protein, GST-tagged | +Inquiry |
DHRS1-11971H | Recombinant Human DHRS1, His-tagged | +Inquiry |
DHRS1-2593H | Recombinant Human DHRS1 Protein, GST-tagged | +Inquiry |
DHRS1-1079R | Recombinant Rhesus Macaque DHRS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DHRS1-4509H | Recombinant Human DHRS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHRS1-6941HCL | Recombinant Human DHRS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHRS1 Products
Required fields are marked with *
My Review for All DHRS1 Products
Required fields are marked with *
0
Inquiry Basket