Recombinant Human DHX36 protein, His&Myc-tagged
| Cat.No. : | DHX36-6743H |
| Product Overview : | Recombinant Human DHX36 protein(Q9H2U1)(89-179aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 89-179a.a. |
| Tag : | His&Myc |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.2 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | ERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGT |
| Gene Name | DHX36 DEAH (Asp-Glu-Ala-His) box polypeptide 36 [ Homo sapiens ] |
| Official Symbol | DHX36 |
| Synonyms | DHX36; DEAH (Asp-Glu-Ala-His) box polypeptide 36; DDX36, DEAD/H (Asp Glu Ala Asp/His) box polypeptide 36; probable ATP-dependent RNA helicase DHX36; KIAA1488; MLEL1; G4 resolvase-1; MLE-like protein 1; DEAH box protein 36; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 36; RNA helicase associated with AU-rich element ARE; G4R1; RHAU; DDX36; |
| Gene ID | 170506 |
| mRNA Refseq | NM_001114397 |
| Protein Refseq | NP_001107869 |
| MIM | 612767 |
| UniProt ID | Q9H2U1 |
| ◆ Recombinant Proteins | ||
| DHX36-425HFL | Recombinant Full Length Human DHX36 Protein, C-Flag-tagged | +Inquiry |
| DHX36-6743H | Recombinant Human DHX36 protein, His&Myc-tagged | +Inquiry |
| DHX36-1600H | Recombinant Human DHX36 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DHX36-2367M | Recombinant Mouse DHX36 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DHX36-759H | Recombinant Human DHX36 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DHX36 Products
Required fields are marked with *
My Review for All DHX36 Products
Required fields are marked with *
