Recombinant Human DLGAP1 Protein, GST-tagged

• Cat.No.: DLGAP1-2680H
• Product Overview: Human DLGAP1 partial ORF ( NP_004737.2, 1 a.a. - 100 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: DLGAP1 (DLG Associated Protein 1) is a Protein Coding gene. Diseases associated with DLGAP1 include Retinitis Pigmentosa 55 and Obsessive-Compulsive Disorder. Among its related pathways are Protein-protein interactions at synapses and Neuroscience. An important paralog of this gene is DLGAP2.
• Molecular Mass: 36.74 kDa
• AA Sequence: MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: DLGAP1 discs, large (Drosophila) homolog-associated protein 1 [ Homo sapiens ]
• Official Symbol: DLGAP1
• Synonyms: DLGAP1; discs, large (Drosophila) homolog-associated protein 1; discs, large (Drosophila) homolog associated protein 1; disks large-associated protein 1; DAP 1; GKAP; SAPAP1; PSD-95/SAP90 binding protein 1; SAP90/PSD-95-associated protein 1; guanylate kinase-associated protein; DAP-1; hGKAP; DAP-1-BETA; DAP-1-ALPHA; FLJ38442; MGC88156
• Gene ID: 9229
• mRNA Refseq: NM_001003809
• Protein Refseq: NP_001003809
• MIM: 605445
• UniProt ID: O14490