Recombinant Human DLGAP1 protein, GST-tagged
Cat.No. : | DLGAP1-3708H |
Product Overview : | Recombinant Human DLGAP1 protein(10 - 68 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 10 - 68 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | DLGAP1 discs, large (Drosophila) homolog-associated protein 1 [ Homo sapiens ] |
Official Symbol | DLGAP1 |
Synonyms | DLGAP1; discs, large (Drosophila) homolog-associated protein 1; discs, large (Drosophila) homolog associated protein 1; disks large-associated protein 1; DAP 1; GKAP; SAPAP1; PSD-95/SAP90 binding protein 1; SAP90/PSD-95-associated protein 1; guanylate kinase-associated protein; DAP-1; hGKAP; DAP-1-BETA; DAP-1-ALPHA; FLJ38442; MGC88156; |
Gene ID | 9229 |
mRNA Refseq | NM_001003809 |
Protein Refseq | NP_001003809 |
MIM | 605445 |
UniProt ID | O14490 |
◆ Recombinant Proteins | ||
DLGAP1-1541R | Recombinant Rat DLGAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DLGAP1-1882R | Recombinant Rat DLGAP1 Protein | +Inquiry |
DLGAP1-3708H | Recombinant Human DLGAP1 protein, GST-tagged | +Inquiry |
DLGAP1-2680H | Recombinant Human DLGAP1 Protein, GST-tagged | +Inquiry |
DLGAP1-3868H | Recombinant Human DLGAP1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLGAP1-226HCL | Recombinant Human DLGAP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLGAP1 Products
Required fields are marked with *
My Review for All DLGAP1 Products
Required fields are marked with *