Recombinant Human DLGAP1 protein, His-tagged

• Cat.No.: DLGAP1-3868H
• Product Overview: Recombinant Human DLGAP1 protein(10 - 68 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 10 - 68 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: DLGAP1 discs, large (Drosophila) homolog-associated protein 1 [ Homo sapiens ]
• Official Symbol: DLGAP1
• Synonyms: DLGAP1; discs, large (Drosophila) homolog-associated protein 1; discs, large (Drosophila) homolog associated protein 1; disks large-associated protein 1; DAP 1; GKAP; SAPAP1; PSD-95/SAP90 binding protein 1; SAP90/PSD-95-associated protein 1; guanylate kinase-associated protein; DAP-1; hGKAP; DAP-1-BETA; DAP-1-ALPHA; FLJ38442; MGC88156
• Gene ID: 9229
• mRNA Refseq: NM_001003809
• Protein Refseq: NP_001003809
• MIM: 605445
• UniProt ID: O14490