Recombinant Human DLGAP1 protein, His-tagged

Cat.No. : DLGAP1-3868H
Product Overview : Recombinant Human DLGAP1 protein(10 - 68 aa), fused to His tag, was expressed in E. coli.
Availability September 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 10 - 68 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : HHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQRNSFQAECVGPFSDPLASS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name DLGAP1 discs, large (Drosophila) homolog-associated protein 1 [ Homo sapiens ]
Official Symbol DLGAP1
Synonyms DLGAP1; discs, large (Drosophila) homolog-associated protein 1; discs, large (Drosophila) homolog associated protein 1; disks large-associated protein 1; DAP 1; GKAP; SAPAP1; PSD-95/SAP90 binding protein 1; SAP90/PSD-95-associated protein 1; guanylate kinase-associated protein; DAP-1; hGKAP; DAP-1-BETA; DAP-1-ALPHA; FLJ38442; MGC88156;
Gene ID 9229
mRNA Refseq NM_001003809
Protein Refseq NP_001003809
MIM 605445
UniProt ID O14490

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DLGAP1 Products

Required fields are marked with *

My Review for All DLGAP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon