Recombinant Human DLST Protein, GST-tagged
Cat.No. : | DLST-2688H |
Product Overview : | Human DLST full-length ORF ( NP_001924.2, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011] |
Molecular Mass : | 75.2 kDa |
AA Sequence : | MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ] |
Official Symbol | DLST |
Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; |
Gene ID | 1743 |
mRNA Refseq | NM_001244883 |
Protein Refseq | NP_001231812 |
MIM | 126063 |
UniProt ID | P36957 |
◆ Recombinant Proteins | ||
DLST-2743H | Recombinant Human DLST protein(151-220 aa), C-His-tagged | +Inquiry |
DLST-897H | Recombinant Human DLST protein, His-tagged | +Inquiry |
DLST-2215H | Recombinant Human DLST Protein, MYC/DDK-tagged | +Inquiry |
Dlst-4256R | Recombinant Rat Dlst protein, His&Myc-tagged | +Inquiry |
DLST-1280R | Recombinant Rhesus monkey DLST Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DLST Products
Required fields are marked with *
My Review for All DLST Products
Required fields are marked with *
0
Inquiry Basket