Recombinant Human DLST Protein, GST-tagged
| Cat.No. : | DLST-2688H |
| Product Overview : | Human DLST full-length ORF ( NP_001924.2, 1 a.a. - 453 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011] |
| Molecular Mass : | 75.2 kDa |
| AA Sequence : | MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DLST dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) [ Homo sapiens ] |
| Official Symbol | DLST |
| Synonyms | DLST; dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex); DLTS; dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2; |
| Gene ID | 1743 |
| mRNA Refseq | NM_001244883 |
| Protein Refseq | NP_001231812 |
| MIM | 126063 |
| UniProt ID | P36957 |
| ◆ Recombinant Proteins | ||
| DLST-1105R | Recombinant Rhesus Macaque DLST Protein, His (Fc)-Avi-tagged | +Inquiry |
| Dlst-2581M | Recombinant Mouse Dlst Protein, Myc/DDK-tagged | +Inquiry |
| Dlst-4256R | Recombinant Rat Dlst protein, His&Myc-tagged | +Inquiry |
| DLST-1280R | Recombinant Rhesus monkey DLST Protein, His-tagged | +Inquiry |
| DLST-1032H | Recombinant Human DLST protein(Asp68-Leu453), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DLST-485HCL | Recombinant Human DLST cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DLST Products
Required fields are marked with *
My Review for All DLST Products
Required fields are marked with *
