Recombinant Human DMP1 Protein, GST-tagged
| Cat.No. : | DMP1-2706H |
| Product Overview : | Human DMP1 partial ORF ( NP_004398.1, 221 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Dentin matrix acidic phosphoprotein is an extracellular matrix protein and a member of the small integrin binding ligand N-linked glycoprotein family. This protein, which is critical for proper mineralization of bone and dentin, is present in diverse cells of bone and tooth tissues. The protein contains a large number of acidic domains, multiple phosphorylation sites, a functional arg-gly-asp cell attachment sequence, and a DNA binding domain. In undifferentiated osteoblasts it is primarily a nuclear protein that regulates the expression of osteoblast-specific genes. During osteoblast maturation the protein becomes phosphorylated and is exported to the extracellular matrix, where it orchestrates mineralized matrix formation. Mutations in the gene are known to cause autosomal recessive hypophosphatemia, a disease that manifests as rickets and osteomalacia. The gene structure is conserved in mammals. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | ESIRSERGNSRMNSAGMKSKESGENSEQANTQDSGGSQLLEHPSRKIFRKSRISEEDDRSELDDNNTMEEVKSDSTENSNSRDTGLSQPRRDSKGDSQEDSKENLSQEES |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DMP1 dentin matrix acidic phosphoprotein 1 [ Homo sapiens ] |
| Official Symbol | DMP1 |
| Synonyms | DMP1; dentin matrix acidic phosphoprotein 1; dentin matrix acidic phosphoprotein; dentin matrix protein 1; ARHP; ARHR; DMP-1; |
| Gene ID | 1758 |
| mRNA Refseq | NM_001079911 |
| Protein Refseq | NP_001073380 |
| MIM | 600980 |
| UniProt ID | Q13316 |
| ◆ Recombinant Proteins | ||
| DMP1-4647M | Recombinant Mouse DMP1 Protein | +Inquiry |
| Dmp1-407M | Active Recombinant Mouse Dentin Matrix Protein 1, His-tagged | +Inquiry |
| DMP1-2803H | Recombinant Human DMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| DMP1-2212H | Recombinant Human DMP1 Protein, MYC/DDK-tagged | +Inquiry |
| DMP1-6727H | Recombinant Human DMP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DMP1-1977HCL | Recombinant Human DMP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DMP1 Products
Required fields are marked with *
My Review for All DMP1 Products
Required fields are marked with *
