Recombinant Human DNASE1L3 Protein, GST-tagged

Cat.No. : DNASE1L3-1535H
Product Overview : Recombinant human full-length DNASE1L3 (NP_004935.1, 1 a.a. - 305 a.a.) was expressed in wheat germ with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0.
Molecular Mass : 61.9 kDa
AA Sequence : MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS
Storage : Store at -80 centigrade.
Gene Name DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ]
Official Symbol DNASE1L3
Synonyms DHP2; DNAS1L3; LSD
Gene ID 1776
mRNA Refseq NM_004944.2
Protein Refseq NP_004935.1
MIM 602244
UniProt ID Q13609

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNASE1L3 Products

Required fields are marked with *

My Review for All DNASE1L3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon