Recombinant Human DNASE1L3 Protein, GST-tagged
Cat.No. : | DNASE1L3-1535H |
Product Overview : | Recombinant human full-length DNASE1L3 (NP_004935.1, 1 a.a. - 305 a.a.) was expressed in wheat germ with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-305 aa |
Description : | This gene encodes a member of the DNase family. The protein hydrolyzes DNA, is not inhibited by actin, and mediates the breakdown of DNA during apoptosis. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0. |
Molecular Mass : | 61.9 kDa |
AA Sequence : | MSRELAPLLLLLLSIHSALAMRICSFNVRSFGESKQEDKNAMDVIVKVIKRCDIILVMEIKDSNNRICPILMEKLNRNSRRGITYNYVISSRLGRNTYKEQYAFLYKEKLVSVKRSYHYHDYQDGDADVFSREPFVVWFQSPHTAVKDFVIIPLHTTPETSVKEIDELVEVYTDVKHRWKAENFIFMGDFNAGCSYVPKKAWKNIRLRTDPRFVWLIGDQEDTTVKKSTNCAYDRIVLRGQEIVSSVVPKSNSVFDFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS |
Storage : | Store at -80 centigrade. |
Gene Name | DNASE1L3 deoxyribonuclease 1 like 3 [ Homo sapiens (human) ] |
Official Symbol | DNASE1L3 |
Synonyms | DHP2; DNAS1L3; LSD |
Gene ID | 1776 |
mRNA Refseq | NM_004944.2 |
Protein Refseq | NP_004935.1 |
MIM | 602244 |
UniProt ID | Q13609 |
◆ Recombinant Proteins | ||
DNASE1L3-1919R | Recombinant Rat DNASE1L3 Protein | +Inquiry |
DNASE1L3-29H | Recombinant Human DNASE1L3 Full Length protein, His-tagged | +Inquiry |
DNASE1L3-5853H | Recombinant Human DNASE1L3 protein, His&Myc-tagged | +Inquiry |
DNASE1L3-1578R | Recombinant Rat DNASE1L3 Protein, His (Fc)-Avi-tagged | +Inquiry |
DNASE1L3-1004HF | Recombinant Full Length Human DNASE1L3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNASE1L3-6864HCL | Recombinant Human DNASE1L3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNASE1L3 Products
Required fields are marked with *
My Review for All DNASE1L3 Products
Required fields are marked with *